SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO12031
Pre Gene Modal
BGIBMGA004312
Annotation
PREDICTED:_sodium-dependent_noradrenaline_transporter_[Bombyx_mori]
Full name
Transporter      
Location in the cell
PlasmaMembrane   Reliability : 4.97
 

Sequence

CDS
ATGACTTATTGTTTTGTATTTGTTTCAGACCACAAGCCAACGAAGGGATCTGTCGTAACCTTATCGTGCTACAAAAAAGAGCCTAAAGTACAAATAGAGGAAGAGTATTTTTATACCGAAGGCAGCAAACGACTTAGAGCGAACAGCAAGCCTGAAACATCAGATGGCCGAGAGACATGGGGCACCGGGGCAGACTTCCTTCTGTCCATCATTGGTTTCGCGGTTGATCTGGCCAACGTCTGGAGATTTCCGTATCTTTGCTATAGGAATGGCGGTGGGGCCTTCTTGATACCCTACACTCTGATGCTGGTTTTCGGAGCAGTTCCTCTGTTCTACATGGAGTTGATCCTAGGGCAGTATAACCGACAAGGACCTATCACTCTATGGAAAATATGTCCATTGTTTAAAGGTGTTGGATTCTGCGCAGTCATGGTTGCGTTTTATGTTTCCTTCTATTATAATGTAATAATTGGCTGGGCTTTCTACTTCTTGATGTCGTCAGCTCGATCAGAACTGCCCTGGGTGCATTGCGATAATTCTTGGAACACGGAACAATGTTGGGACTCGGCTCGGTTGAATGGTACCAATCGCACGGATGTTAAATACCAAGGACCACTGTCGCATTTCACGCCCGCTTCAGAATTCTTTCATCGAGCAGTCCTGGAAATGCAGCATTCGGAAGGTTTGAATGATCTAGGTTTGCCGAAATGGCAATTGGCTGCTTGTCTCGGTTTGGTCTATGTAACTTTATACCTTTCATTATTCAAAGGCGTTAAAAGCTCCGGAAAAGTGGTATGGATGACAGCAACAATGCCGTACGTTGTCCTGTCGATCCTCCTGGCCCGTGGATTACTTCTGCCGGGAGCAACACGGGGCATCGCCTACTATTTGCAGCCGGAACTTACTAGGCTCAAGGATACGCAGGTTTGGGTGGATGCAGCGGTGCAGATATTTTATTCCGTTGGTGCTGGTTTCGGCGTTCATCTTTCATATGCAAGTTACAACACTTTTCACAACAATTGCTACAGGGATTGCTTGGTTACAACTCTAGTGAATTGTTTCACGTCATTCTTCTCCGGGTTCGTGATCTTCACGTACCTCGGGTTCATGTCGTACAAACAGGGTGTACCCATTTCCTCCGTGGCTACTGAAGGACCAGGATTGGTATTCCAAGTATACCCCGAGGCTGTTGCTACTCTACCGGGGGCGAGCTTATGGGCGATGTTGTTCTTCTTTATGCTGATCATGCTTGGACTGGACTCGGGGATGGGTGGTCTCGAGTGTGTGATCACCGGTCTTTTGGACCAGGCGCGTGCGAGCGGTGCACACTGGCTCCGCCGGGAGCACTTCACGCTGCTGGTCGTCTGTGTGTCCTTCTGTATCGCTTGCATCAATGTAACACCGGGTGGAATTTACATGTTTCATCTTTTGGACACCTACGCTGCCGGCATATCACTGTTGTGCTCGGCGTTGTTCGAAGCCGTTGCTGTCTCGTGGTTTTATGGTCTGAAAAGGTTCTCTGACGATGTTGAAGAAATGCTCGGCTTCAGGCCCGGTATTTACTGGAGGATATGCTGGAAATTTGTCAGCCCAATATTCATTATCGGAGTAGTAGTTTTCGGCTTATTGTACCAGCAGCCTCTTCAGTATCAGCAATACACGTATCCGCAGTGGGCCGTGGTGTTGGGCTGGGGTCTGGCCTGCTCCTCCATATTAATGATACCTATCGTAGCTATATACAAACTGGCCACAACTCCCGGAACATTTAGACAGCGTCTTGCTTGCTGCATTTCTCCTGAATCCGAACACGAAGCCATCCGAGGTGGGGCTCCCGTCAGTCGCTTCACGTGGCGACATTGGTTATATGTATAA
Protein
MTYCFVFVSDHKPTKGSVVTLSCYKKEPKVQIEEEYFYTEGSKRLRANSKPETSDGRETWGTGADFLLSIIGFAVDLANVWRFPYLCYRNGGGAFLIPYTLMLVFGAVPLFYMELILGQYNRQGPITLWKICPLFKGVGFCAVMVAFYVSFYYNVIIGWAFYFLMSSARSELPWVHCDNSWNTEQCWDSARLNGTNRTDVKYQGPLSHFTPASEFFHRAVLEMQHSEGLNDLGLPKWQLAACLGLVYVTLYLSLFKGVKSSGKVVWMTATMPYVVLSILLARGLLLPGATRGIAYYLQPELTRLKDTQVWVDAAVQIFYSVGAGFGVHLSYASYNTFHNNCYRDCLVTTLVNCFTSFFSGFVIFTYLGFMSYKQGVPISSVATEGPGLVFQVYPEAVATLPGASLWAMLFFFMLIMLGLDSGMGGLECVITGLLDQARASGAHWLRREHFTLLVVCVSFCIACINVTPGGIYMFHLLDTYAAGISLLCSALFEAVAVSWFYGLKRFSDDVEEMLGFRPGIYWRICWKFVSPIFIIGVVVFGLLYQQPLQYQQYTYPQWAVVLGWGLACSSILMIPIVAIYKLATTPGTFRQRLACCISPESEHEAIRGGAPVSRFTWRHWLYV

Summary

Similarity
Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family.
Feature
chain  Transporter
EMBL
NWSH01000515    PCG75918.1    AF388173    AAL09578.2    KP657645    AKL78870.1    + More
KQ459460    KPJ00846.1    DQ097796    AAZ08592.2    DQ097797    AAZ08593.2    ODYU01005982    SOQ47426.1    KQ461181    KPJ07672.1    RSAL01000132    RVE46344.1    AGBW02011555    OWR46493.1    BABH01032501    KQ971354    KYB26417.1    GEZM01016170    JAV91351.1    DS235200    EEB13194.1    GEDC01028669    GEDC01014839    JAS08629.1    JAS22459.1    KK852611    KDR20283.1    GFTR01007659    JAW08767.1    GBBI01002650    JAC16062.1    GGMS01017893    MBY87096.1    ABLF02030771    GGLE01006912    MBY11038.1    GEGO01003692    JAR91712.1    ACPB03005112    GBHO01014204    JAG29400.1    KF321729    AGY96957.1    JH431850    KK113908    KFM61330.1    KF321730    AGY96958.1    KF321731    AGY96959.1    ABJB010134719    ABJB010470067    ABJB010499826    ABJB010927746    ABJB011106229    DS746704    EEC07753.1    GDRN01108184    JAI57300.1    HACA01023888    CDW41249.1    APGK01028545    KB740694    ENN79419.1    CP026247    AWP01893.1    AHAT01020181    AHAT01020182    AHAT01020183    AYCK01004742    GCES01057633    GCES01013368    JAR28690.1    MH085049    AXS75745.1    CM004473    OCT82188.1    BX663609    AHAT01020906    AF318177    AAK52449.1    U72877    AAB67676.1    AMQN01000284    KB308724    ELT96928.1    LSYS01005191    OPJ77867.1    RJVU01077109    ROI15904.1    QUSF01000023    RLW01230.1    LMAW01002501    KQK80910.1    DQ813341    ABG91820.1    MUZQ01000095    OWK58581.1    NHOQ01000682    PWA29135.1    AEFK01053212    AEFK01053213    AEFK01053214    AEFK01053215    AEFK01053216    AEFK01053217    AEFK01053218    AEFK01053219    HADW01020475    HADX01008531    SBP21875.1    CM004477    OCT74385.1    AGCU01072366    AGCU01072367    AGCU01072368    AGCU01072369    AGCU01072370    JARO02001429    KPP75498.1    AKCR02000031    PKK25798.1    ABQF01035888    ABQF01035889    ABQF01035890    ABQF01035891   
Pfam
PF00209   SNF        + More
PF09068   EF-hand_2
PF09069   EF-hand_3
PF00569   ZZ
PF00246   Peptidase_M14
PF02244   Propep_M14
PF13499   EF-hand_7
PF13202   EF-hand_5
PF01553   Acyltransferase
Interpro
IPR037272   SNS_sf        + More
IPR000175   Na/ntran_symport       
IPR015153   EF-hand_dom_typ1       
IPR015154   EF-hand_dom_typ2       
IPR011992   EF-hand-dom_pair       
IPR000433   Znf_ZZ       
IPR003146   M14A_act_pep       
IPR036990   M14A-like_propep       
IPR000834   Peptidase_M14       
IPR034223   IGCP-like_CPD       
IPR002123   Plipid/glycerol_acylTrfase       
IPR002048   EF_hand_dom       
IPR018247   EF_Hand_1_Ca_BS       
IPR002436   Na/ntran_symport_dopamine       
IPR002435   Na/ntran_symport_noradrenaline       
SUPFAM
SSF161070   SSF161070        + More
SSF47473   SSF47473       
Gene 3D
PDB
4XPA     E-value=9.02863e-160,     Score=1448

Ontologies

Topology

Length:
623
Number of predicted TMHs:
12
Exp number of AAs in TMHs:
260.59724
Exp number, first 60 AAs:
0.36023
Total prob of N-in:
0.71133
inside
1  -  65
TMhelix
66  -  85
outside
86  -  94
TMhelix
95  -  117
inside
118  -  137
TMhelix
138  -  160
outside
161  -  236
TMhelix
237  -  255
inside
256  -  263
TMhelix
264  -  286
outside
287  -  314
TMhelix
315  -  337
inside
338  -  349
TMhelix
350  -  372
outside
373  -  396
TMhelix
397  -  419
inside
420  -  448
TMhelix
449  -  471
outside
472  -  480
TMhelix
481  -  503
inside
504  -  523
TMhelix
524  -  543
outside
544  -  557
TMhelix
558  -  580
inside
581  -  623
 
 

Population Genetic Test Statistics

Pi
233.908139
Theta
191.023341
Tajima's D
0.9982
CLR
0.456477
CSRT
0.654317284135793
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号