SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO11988
Pre Gene Modal
BGIBMGA004264
Annotation
Retrovirus-related_Pol_polyprotein_from_transposon_17.6_[Exaiptasia_pallida]
Location in the cell
Nuclear   Reliability : 3.064
 

Sequence

CDS
ATGACTGAAACATCCACAACAAACATGGTGTCAGGTGTGGGGTTCCTGCCACTTTTACCCAGTATGGATTTCAAAGGTAACCTTGCCGAAAATTTCAAAATGTATCGTCAAAGGTTGGAGATATATTTGTCTGCTAATGGCCTTGATGACGCCAAAGACAAAAGAAAAATATCAATTCTGCTGAATTTTATTGGCGAAAACGGAATCAAAATCTACAATTCTTTCAACTTAAACGCATCTGAATCACATACTTTTGAACACGTGCTCAAAAAGTTTGAAGCGTACTTTGAACCAAAGAAAAGTCTAACTATAGCAAGGAACGAGTTTTTTACTGTTACACAAGATGAAGACAGGTTGGAGGATTACTTTCAAAGAGTAATAAATCTCGGTATTCAATGCGAACTTGGAGATCTCAGAGAAGGGTTGACAGTGGGAAAGATAATTTCAGGGTTAGACTCCAAATATAATAATCTCAAAACACGATTAATGTCGGAAGACGATAGTAAATTAACATTAGATTATGTTATGAAATACTTACTGAGTGCCGAAACCTCTAGAAAATATATAGAAGAAAAAACAAATTCAAAGGACAGCGATGAGTCCTCCATCCTATATGTTAATAAAAAATCAATAAGGAACTGTAGAAACTGTGGCACATCTCACAATATAAATAAATGCCCAGCATACGGCAAGGAGTGTCTGAAGTGCAAGAAACTTAACCATTTTAGTAAAGTATGCAGATCAGCCAAGAAACCAAATTTTTATCAAAAGCAAGTCAATGTCCTTGAGGATCCAGATAGGAACAAAGAGGATGAAGCTGAAGGAGATTTCTTTGTTGGTTATGCAGGCAATGAAATAATTCAAGATTTTACAGTCAATAACATCAAAATTCCCATCAAAATGGACACTGGAGCTGCATGCAACGTGATTGGGAGTGAATGA
Protein
MTETSTTNMVSGVGFLPLLPSMDFKGNLAENFKMYRQRLEIYLSANGLDDAKDKRKISILLNFIGENGIKIYNSFNLNASESHTFEHVLKKFEAYFEPKKSLTIARNEFFTVTQDEDRLEDYFQRVINLGIQCELGDLREGLTVGKIISGLDSKYNNLKTRLMSEDDSKLTLDYVMKYLLSAETSRKYIEEKTNSKDSDESSILYVNKKSIRNCRNCGTSHNINKCPAYGKECLKCKKLNHFSKVCRSAKKPNFYQKQVNVLEDPDRNKEDEAEGDFFVGYAGNEIIQDFTVNNIKIPIKMDTGAACNVIGSE

Summary

EMBL
MRZV01000161    PIK56894.1    ABLF02013930    ABLF02013934    MRZV01000519    PIK48493.1    + More
HADY01023773    HAEJ01006887    SBS47344.1    KK118858    KFM74040.1    GGMR01000868    MBY13487.1    GGMR01005013    MBY17632.1    HAED01014930    SBR01375.1    AGBW02008504    OWR53150.1    HADZ01022257    SBP86198.1    GEZM01020000    JAV89472.1    GCES01104253    JAQ82069.1    GEZM01041944    JAV80090.1    GCES01110503    JAQ75819.1    GEZM01035137    JAV83383.1    GACK01009641    JAA55393.1    GEZM01001974    JAV97427.1    GBGD01000115    JAC88774.1    GEZM01050758    JAV75411.1    GBGD01000119    JAC88770.1    NWSH01000088    PCG79705.1    HAED01020456    SBR07020.1    ABLF02038957    GCES01096219    JAQ90103.1    MRZV01000033    PIK61397.1    AERX01076149    KF319019    AIE48224.1    GBHO01004090    JAG39514.1    MRZV01000718    PIK45343.1    GEZM01001973    JAV97431.1    AERX01070080    ABLF02041865    ACPB03002101    ACPB03002102    ACPB03002103    GGMR01004179    MBY16798.1    ACPB03019169    GBBI01004745    JAC13967.1    GDHC01013957    JAQ04672.1    NCKU01019406    RWR98729.1    ABLF02010707    KV461054    OCA14957.1    KQ980844    KYN12280.1    MRZV01000723    PIK45255.1    ABLF02008456    GEZM01050997    GEZM01050995    JAV75219.1    ABLF02019772    KK122208    KFM82237.1    GEZM01079607    GEZM01079598    JAV62391.1    MRZV01000576    PIK47528.1    ACPB03023527    GEZM01043682    JAV78912.1    RSAL01000037    RVE51181.1    CM004469    OCT91956.1    HADY01023564    SBP62049.1    GEZM01097791    JAV54106.1    GEZM01102055    GEZM01102054    GEZM01102053    GEZM01102051    JAV52011.1    MRZV01000618    PIK46835.1    ABLF02041541    GFPF01012437    MAA23583.1    KQ982635    KYQ53341.1    MRZV01000245    PIK54530.1    MRZV01000347    PIK51998.1    ABLF02008619    GEZM01011167    JAV93615.1    GEZM01060849    JAV70854.1   
Pfam
PF00078   RVT_1        + More
PF00665   rve
PF17921   Integrase_H2C2
PF17919   RT_RNaseH_2
PF00412   LIM
PF02209   VHP
PF17917   RT_RNaseH
Interpro
IPR021109   Peptidase_aspartic_dom_sf        + More
IPR012337   RNaseH-like_sf       
IPR001584   Integrase_cat-core       
IPR041577   RT_RNaseH_2       
IPR000477   RT_dom       
IPR041588   Integrase_H2C2       
IPR036397   RNaseH_sf       
IPR001878   Znf_CCHC       
IPR001995   Peptidase_A2_cat       
IPR001969   Aspartic_peptidase_AS       
IPR001781   Znf_LIM       
IPR003128   Villin_headpiece       
IPR036886   Villin_headpiece_dom_sf       
IPR036875   Znf_CCHC_sf       
IPR041373   RT_RNaseH       
SUPFAM
SSF50630   SSF50630        + More
SSF53098   SSF53098       
SSF47050   SSF47050       
SSF57756   SSF57756       
Gene 3D
PDB
2BL6     E-value=0.0317176,     Score=86

Ontologies

Topology

Length:
313
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.32237
Exp number, first 60 AAs:
0.31168
Total prob of N-in:
0.08612
outside
1  -  313
 
 

Population Genetic Test Statistics

Pi
6.386078
Theta
15.605955
Tajima's D
-1.183965
CLR
199.338417
CSRT
0.106344682765862
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号