SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO11936  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA004467
Annotation
PREDICTED:_hemolymph_protein_isoform_X1_[Bombyx_mori]
Full name
Microvitellogenin       + More
Low molecular mass 30 kDa lipoprotein 21G1      
Low molecular 30 kDa lipoprotein PBMHP-12      
Low molecular 30 kDa lipoprotein PBMHPC-23      
Low molecular mass 30 kDa lipoprotein 19G1      
Low molecular 30 kDa lipoprotein PBMHP-6      
Low molecular 30 kDa lipoprotein PBMHPC-19      
Low molecular 30 kDa lipoprotein PBMHPC-21      
Location in the cell
Cytoplasmic   Reliability : 1.083 Extracellular   Reliability : 1.774
 

Sequence

CDS
ATGAAAACCTTGGCAATCTTTTCGCTGTGCGTGCTGGCTGTCAGCGCCGGCCTCATCGACATCGACATTGACATCCTATCCGCTCCGACAAACGTGGAAGTGGACAGGCTTTACAACAGCATCGTTACCGGAGACATTGACAGGGCTGTTGCTCAAACTTTGGCGCTAGAGGGACTTTCAAGGGGAGCTATCATTGAAGATGTCGTTGACAGGCTCATCAGGGAAAAGAAGAGGAACACCTTCGATTACGCTTATAAACTCTGGAGCAGTGATGGACAGGATATCGTCACACAACACTTCCCTATTCAGTTCAGATTGATCTTGGCCGAGAACCATGTCAAGCTCATCAACAAGAGGGACAATCTCGCCATCAAACTCGGCGCTGCAGTGGATCACGAAAATGACAGAACCGCTTTCGGTGACGCCAACGACAAGACCACAGACAACGTCGGCTGGAGATTTGTTCACTTGTGGGATAACAAAAAGGTGTACTTCAAGATCATTAGCATTGCCCGTAACCAATTCTTGAAACTGGGCTCTGCTGCTGACGACGCTGGTGACCACACCGCTTATGGGGACAACAAAGCCAACACCTTCAGACACCAGTGGTACCTGCAGCCCGCTTTTGTCGAAAAGGAAGTCGTGTTCATCGTCTACAACCGCGAGTTCAACCAGGCTCTGAAGCTCGGCAGAGCAGTGGATTCGGACGGAGACCGCAACGTATACGGACACAATGGAGACGTGTCCGGCTCCCCTGAACTCTTCGGTTTCACTGTCTCTCCTCTGTAG
Protein
MKTLAIFSLCVLAVSAGLIDIDIDILSAPTNVEVDRLYNSIVTGDIDRAVAQTLALEGLSRGAIIEDVVDRLIREKKRNTFDYAYKLWSSDGQDIVTQHFPIQFRLILAENHVKLINKRDNLAIKLGAAVDHENDRTAFGDANDKTTDNVGWRFVHLWDNKKVYFKIISIARNQFLKLGSAADDAGDHTAYGDNKANTFRHQWYLQPAFVEKEVVFIVYNREFNQALKLGRAVDSDGDRNVYGHNGDVSGSPELFGFTVSPL

Summary

Miscellaneous
This lipoprotein belongs to the group of structurally related '30 kDa proteins' that comprise major protein components of the fifth (and last) instar larvae and of pupae.
Biosynthesis occurs in a stage-dependent fashion in the fat body.
Similarity
Belongs to the 30 kDa lipoprotein family.
Keywords
Signal   Complete proteome   Lipoprotein   Reference proteome   Secreted   3D-structure  
Feature
chain  Microvitellogenin
EMBL
BABH01021999    BABH01022000    D12523    BAA02093.1    BABH01021994    JN977526    + More
AFC87806.1    M28820    J03768    BABH01021998    JN977527    AFC87807.1    AM293331    CAL25136.1    BABH01021941    JN977524    AFC87804.1    JN977525    AFC87805.1    X54734    X07553    AB158646    BAD07027.1    KM926620    AJI02615.1    BABH01021929    JN977543    AFC87823.1    EU024295    ABS71120.1    BABH01021935    JN977529    AFC87809.1    X07556    BABH01021988    BABH01021930    BABH01021936    HM012806    JN977520    ADQ89805.1    AFC87800.1    AY568957    AAS75435.1    BABH01021937    JN977519    AFC87799.1    FJ214661    ACO35751.1    AB553284    BAJ04788.1    X54736    JN977528    AFC87808.1    X07552    X54735    CAA38532.1    FJ214660    ACO35750.1    AB553283    BAJ04787.1    X07554    JN977535    AFC87815.1    JN977521    AFC87801.1    JN977522    AFC87802.1    BABH01021931    BABH01021932    BABH01021933    BABH01021934    X07555    BABH01021908    BABH01021925    JN977523    AFC87803.1    JN977534    AFC87814.1    BABH01028980    JN977545    AFC87825.1    AB436163    BAG70410.1    JN977536    AFC87816.1    JN977539    AFC87819.1    BABH01026782    JN977537    AFC87817.1    BABH01036437    JN977541    AFC87821.1    BABH01011413    DQ306881    JN977531    ABC18268.1    AFC87811.1    BABH01028979    JN977530    AFC87810.1    BABH01026781    JN977532    AFC87812.1    BABH01022003    BABH01021921    BABH01022014    BABH01022005    BABH01022007    JN977540    AFC87820.1    JN977544    AFC87824.1    KQ460930    KPJ10718.1    KQ459582    KPI98870.1    KZ149940    PZC76929.1    MG799571    AXY55009.1    BABH01043627    HM012807    ADQ89806.1    JN977533    AFC87813.1    JN977538    AFC87818.1    BABH01022004    NWSH01005147    PCG64400.1    BABH01035696    MF497270    AUB45122.1    KZ149893    PZC78944.1    NWSH01000685    PCG74802.1    BABH01022013    AB098260    BAC82630.1    PZC78918.1    MF497269    AUB45121.1    NWSH01000017    PCG80765.1    BABH01043629    BABH01022006    BABH01040631    ODYU01010790    SOQ56108.1    JN977542    AFC87822.1   
Pfam
PF03260   Lipoprotein_11
Interpro
IPR004943   Lipoprotein_11        + More
IPR042046   Lipoprotein_11_N       
IPR035992   Ricin_B-like_lectins       
SUPFAM
SSF50370   SSF50370       
Gene 3D
PDB
4PC4     E-value=2.03548e-62,     Score=604

Ontologies

Topology

Subcellular location
  
SignalP
Position:   1 - 16,         Likelihood:  0.993484
 
 
Length:
262
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
1.42829
Exp number, first 60 AAs:
1.42709
Total prob of N-in:
0.08089
outside
1  -  262
 
 

Population Genetic Test Statistics

Pi
159.108397
Theta
156.65435
Tajima's D
0.766089
CLR
0
CSRT
0.589820508974551
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号