SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO11874
Annotation
reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.994
 

Sequence

CDS
ATGCTGGGAGTTCTCAACAGAGCGAAGCGGTACTTCACGCCTGGACAAAGGCTTTTGCTTTATAAAGCACAAGTCCGACCTCACTTGGAGTACTGCTCCCATCTCTGGGCCGGGGCTCCCAAATACCAGCTACTTCCATTTGACTCCATACAGAGGAGGGCCGTTCGGATTGTCGATAATCCCATTCTCACGGATCGTTTGGAACCTCTGGGTCTGCGGAGGGACTTCGGTTCCCTCTGTATTCTGTACCGTATGTTCCATGGGGAGTGCTCTGAGGAATTGTTCGAGATGATAGCGACATCTCGTTTTTACCATCGCTCCGCCCGCCACCGGAGTAGAGTTCATCCATATTACCTGGAGCCACTGCGTTCATCCACAGTGCGTTTCCAGAGGTCTTTTTTGCCACGTACCATCCGGCTATGGAATGAGCTCCCTTCCACGGTGTTTCCCGAGCGCTATGACATGTCCTTCTTCAAACGAGGCTTGTGGAGAGTATTAAACGGTAGGCAGCGGCTTGGTTCTCCCCCTGGCGTTGCTGACGTCCATGAGCGACGGTAA
Protein
MLGVLNRAKRYFTPGQRLLLYKAQVRPHLEYCSHLWAGAPKYQLLPFDSIQRRAVRIVDNPILTDRLEPLGLRRDFGSLCILYRMFHGECSEELFEMIATSRFYHRSARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVLNGRQRLGSPPGVADVHERR

Summary

Similarity
Belongs to the protein kinase superfamily. Tyr protein kinase family.
EMBL
AB126052    BAD86652.1    AY359886    AAQ57129.1    RSAL01002067    RVE40593.1    + More
RSAL01000164    RVE45343.1    RSAL01003136    RVE40332.1    RSAL01000002    RVE54942.1    FM995623    CAX36785.1    RVE55041.1    RVE55094.1    RSAL01000422    RVE41792.1    ODYU01002162    SOQ39302.1    ODYU01007424    SOQ50185.1    AMCI01002135    EJX03495.1    HAAD01001474    CDG67706.1    RSAL01000193    RVE44603.1    ODYU01000366    SOQ35027.1    RSAL01000058    RVE49758.1    DPOC01000269    HCX22453.1    LWDP01000391    ORD92879.1    RSAL01000030    RVE51708.1    RSAL01000110    RVE47159.1    GDRN01105059    JAI57791.1    ODYU01004409    SOQ44252.1    ODYU01011959    SOQ58001.1    ODYU01007423    SOQ50184.1    ODYU01006795    SOQ48973.1    ODYU01003793    SOQ42997.1    KZ505886    PKU43598.1    MRZV01001153    PIK40187.1    AAGJ04079835    AAGJ04112043    AGCU01000442    AGCU01063261    AGCU01082246    AGCU01035999    AGCU01094663    AGCU01122093    GEFM01001453    JAP74343.1    AGCU01040360    KL217727    KFO98087.1    GFAA01002385    JAU01050.1    AGCU01203047    AGCU01168699    GEGO01004630    JAR90774.1    KL217824    KFO99526.1    KL218275    KFP03813.1    GFAC01000919    JAT98269.1    AGCU01033893    AGCU01073976    KL217898    KFO99982.1    GFAC01000877    JAT98311.1    QRBI01000092    RMC22480.1    KL217842    KFO99658.1    QRBI01000123    RMC05540.1    AGCU01015466    AGCU01031348    KL218790    KFP08260.1    KL217819    KFO99425.1    KL217887    KFO99825.1    KL217628    KFO97213.1    AGCU01117056    AGCU01165999    QRBI01000144    RMC00666.1    GBZX01002173    JAG90567.1    KZ505669    PKU47808.1    KZ505691    PKU47026.1    KL217820    KFO99518.1    RMC05275.1    KL217834    KFO99597.1    KL218794    KFP08560.1    KL218170    KFP02963.1    KL218510    KFP06135.1    AAGJ04095885    KL218253    KL218506    KL218617    KL218759    KFP03494.1    KFP06081.1    KFP07017.1    KFP07846.1    KL218277    KFP03922.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF01873   eIF-5_eIF-2B
PF01585   G-patch
PF08159   NUC153
PF00458   WHEP-TRS
PF02182   SAD_SRA
PF00097   zf-C3HC4
PF00086   Thyroglobulin_1
PF07714   Pkinase_Tyr
PF00083   Sugar_tr
PF16030   GD_N
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR016190   Transl_init_fac_IF2/IF5_Zn-bd       
IPR002735   Transl_init_fac_IF2/IF5       
IPR016189   Transl_init_fac_IF2/IF5_N       
IPR012677   Nucleotide-bd_a/b_plait_sf       
IPR000504   RRM_dom       
IPR034653   SPF45_RRM       
IPR003954   RRM_dom_euk       
IPR000467   G_patch_dom       
IPR040052   RBM17       
IPR035979   RBD_domain_sf       
IPR036322   WD40_repeat_dom_sf       
IPR040382   NOL10/Enp2       
IPR012580   NUC153       
IPR001680   WD40_repeat       
IPR000738   WHEP-TRS_dom       
IPR009068   S15_NS1_RNA-bd       
IPR013083   Znf_RING/FYVE/PHD       
IPR036987   SRA-YDG_sf       
IPR018957   Znf_C3HC4_RING-type       
IPR015947   PUA-like_sf       
IPR017907   Znf_RING_CS       
IPR001841   Znf_RING       
IPR003105   SRA_YDG       
IPR036857   Thyroglobulin_1_sf       
IPR000716   Thyroglobulin_1       
IPR000719   Prot_kinase_dom       
IPR008266   Tyr_kinase_AS       
IPR020635   Tyr_kinase_cat_dom       
IPR017441   Protein_kinase_ATP_BS       
IPR001245   Ser-Thr/Tyr_kinase_cat_dom       
IPR011009   Kinase-like_dom_sf       
IPR036259   MFS_trans_sf       
IPR020846   MFS_dom       
IPR005828   MFS_sugar_transport-like       
IPR031986   GD_N       
SUPFAM
SSF56219   SSF56219        + More
SSF75689   SSF75689       
SSF100966   SSF100966       
SSF54928   SSF54928       
SSF50978   SSF50978       
SSF47060   SSF47060       
SSF88697   SSF88697       
SSF57610   SSF57610       
SSF56112   SSF56112       
SSF103473   SSF103473       

Ontologies

Topology

Subcellular location
Nucleus  
Length:
185
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.000730000000000001
Exp number, first 60 AAs:
0.0002
Total prob of N-in:
0.17818
outside
1  -  185
 
 

Population Genetic Test Statistics

Pi
73.642178
Theta
67.470554
Tajima's D
0.28572
CLR
2.648062
CSRT
0.459777011149443
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号