SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO11870  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA004414
Annotation
PREDICTED:_microtubule-actin_cross-linking_factor_1?_isoforms_1/2/3/5_[Amyelois_transitella]
Full name
Plectin       + More
Dystonin      
Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5      
Microtubule-actin cross-linking factor 1      
Periplakin      
Alternative Name
Plectin-1
Plectin-6
300 kDa intermediate filament-associated protein
IFAP300
Hemidesmosomal protein 1
230 kDa bullous pemphigoid antigen
230/240 kDa bullous pemphigoid antigen
Bullous pemphigoid antigen 1
Dystonia musculorum protein
Hemidesmosomal plaque protein
Microtubule actin cross-linking factor 2
620 kDa actin-binding protein
Actin cross-linking family protein 7
Macrophin-1
Trabeculin-alpha
Actin cross-linking family 7
190 kDa paraneoplastic pemphigus antigen
195 kDa cornified envelope precursor protein
Location in the cell
Cytoplasmic   Reliability : 1.472 Nuclear   Reliability : 1.898
 

Sequence

CDS
ATGTACGGCAGCGGTTTCGCCCAGGCCGAGACACTGGGCACCGGCGCCGGAACGAACGCTGGCTTAGCCTGCGACACAGAGGGTGCCGAGGCTTTGATGTCTGGGCCGGAAGCTCGGAGGCGGGTGAATCCATCCGTCGATGAGACGGGGGCAAGGTCGACCTCCATCTCCGAGTCAGAGTCGGAGGACGAGCAGGCGGGCGCAGGTGACCTACGAGTAGGTGTTTTGGAGGGCGCGACGGAGGCCGCGGATGATCGCGCTGCTGGAATGGTGACCACGGCGGACGACGCAGCAGTTTTACTCGCCAGTATAGGCGACGCGGGAACGGCAGGCACGACGGAGGCTGCGGTGCTCGATGCAGAAGCTTTGCACGCAGGTACAGGCGACGCAGGAGCAGCGAGCGCGGCGGAGGACATCAAACAAACCGAAAGCGGTCTGGACAGCGTGGAGCGGCACATCGAGGGGGAGCTGCGTCGCGTGGAGCGCGGCGTGCACCCCGCCGACGCCAAGACCGCCGCCGAGCAGATCGAGCACGACCTGCGCGCCATGGAGCTCGCGCTGCACGAGATGTTCCAGGACGCGAACGCGCTCCGGGAGGGGAGGTACCCGCAAGCCAACGAGCTGCACAGGCGCGTGCAGCAACTCCAGGAGCGCTGGGCGCTGGCCCGACAGGCGCTGGCGAGCCGGCTGGTGCCGCGGCTGGCGGGCGTGCGCATGCCCGTGCAGCACACCACCGTGCGCCGCGAGACCCGCACCGTGCTGGAGACGCGCGTGCACGATGCCGACCCGCGCTTCCACCAGCTCGCCGACGCCGCCGCCTGGTGCCGGGACAAACTGAAAAAACTTCACGAATCAGAATACGGCTCCGACCTGCCGTCGGTGCTGCACGAGCTGGACAAACACCAGCGGGAACACAAACTGATCGACCAGTTCCATTCCAAGGTTGAACAGTGCGTCCACAACCGCTCCAACTTCAACGGCGAAGAGTTGAATTTGTACAACCAGCATCTGAGTCAGTTGCAAAAGTTATACGCCGAGCTACTGTCTACTAGTACTAAGCGGATGTCGGATCTGGACGCGTTACACGACTTCCTTCAATCAGCGACGGCGGAGTTGAACTGGCTCAACGAGAAGGAACAAGTGGAGTTGTCTCGCGACTGGGCCGACCCGCACATCAACCTGCCCGCCGTGCAGCACTATTACGAGCAACTCATGTCGTCCCTTGAGAAGCGGGAGCTCCAGTTCAGCAACGTGATCGACCGCGGCGAGGCGCTCATCGCGCAGCACCACCCCGCCACCAAGACCATCGAGAGCCACCTGCAGGTGATGCAGTCTCAATGGGCATGGGTGCTCCAGCTGACCCTCTGCTTGGAGACCCACTTGAAACACACCACGCAGTACCACACCTTCTTCGAGGAGATCAAAGAGGCGGAGAAATGGATCGCAAAACGCGAGGAAGCATTAAACACGACATTCTCCCAATCGGAGTTCACCTTGGACCAGGGGGAGAGGCTCCTCAAGGGCATGCAGGACCTTCGGGAAGAGCTGAACACGCACGGAGCCGCCGTGTCGCGTCTCGTCGAGGAGGCGCAGGAAGTCAGGCCCGTCAAGCTGCGGAGGGCGCCCGTCACCAGACCCATCAGGGCTGAGACCGTATGCGCGTACAAACACGCTAATGTGGCGATCGAGAAGGGCGCGTCGCTGTCGGTGGTGGACAACTCCGGGCGCAGCCGGTGGCGCGTGCGGCTGGGCGGCGCGGGCTCCGAGGCGCAGGTGCCGGGCGCCGTGCTGGCGCTGCCGCCGCCCTGCCGCGACGCGCTCGCCGCCGCCGACGCGCTGCGGGCACAGCTCGACCGGGTCATCCACCTGTGGCAGAGGAAGCAACTCCGAATGAGACAGAACATGATTTTCGCGACCATCAAAGTTGTGAAAGGCTGGGACTTCCCTCAGTTCGTGGCGATGGGAGCAGAGCAACGTCAGGCCATCCGCCGCGCCCTTAACGAGGACGCGGAGAAGCTGCTCGCCGAGGGAGACCCCGCCGACCCGCAGCTGAGGAGGCTGCGTCGGGAGATCGATGACGTCAACAGGCTGTTTGACGAGTTCGAGCGCAGAGCCAGAGCTGAGGAGGAATCCAAAAATGCAGCTCGCATCTTCACCGAACAATCCACCCACCTGCTGGAACGGCTGGAAGTGCTTGAACGACAGCTACACGAGAGGATCGCGAGCCACATCCCGAGAGACCTGGACTCTTTAGAACACCTGGTGCTCCAGCACAAAGACTGGGAGGGAAACCTGCACGCGCTCTCCGGAGATGTCGAAGAAGCGCAGTCTACATTCAGAGGCATAGCCCTCAAGACCCCAGCAATGAAGAAGAGTCTCGACAAAGTAATGGGCAAGTGGAACGACCTGCATTCAAAGAGTCAACTGTTTGTTGAAAGATTGAAATTCGTCGAGATCGTGGTGAACAGCGTGGAGGAGAACCACCAGGTCATATCCGAGTTTGAAATCAAATTGGCGCAGTTCAGTGACCTACCGAACGACATTGAAATTCTTAAAGACATCCACGAAGACCTGCTCCGCATGCAAGTGGCGGTGAGCAAGCAACAGATCCAGGTGGACCAGATGAACGACGACGCGGAGAACTGCCGGCGGCTCGTGCACGCCTCCCGGGACGCGCTGCCGCACTCCTCGCTGCCGCGCGCCGGCAAGCACCAGGACCTCGAGCGCCTGGACAAGGAGGTGGCGCAGCTCAACGCCAGGTGGAGCAACGTCTGCACTCAGCTGGCCGAGAGGCTTCGAAGTTGCGAGGCCGCCTACCAGCTGCTGCGCAACTACAACGCGGGACTCGAGAAGGAAGCCGAGTGGATCGACGACGCATACAAGCGGCTCCAAGCGCAGCCGCCCGTCGAAGTCAGGCCCAAAGAACAGTTCGAGCCCACCAGGAATCTGCTGACAAGCGTTGTGGAGAGGACGCCAAAGATTGAGAAGGTTAACGTGGACGGCGGACGATTCATACGTGAAGCGAAGATAAACTCGTCGAGATGCCAGCGTTACACGGAGTGGCTTTGTGAGGAGGTCCACCCGTCACTGGATGTCAGGCATTTGAGGCGCCAGGCCGACCTGGACCAGGCCGAGAGGATCCGGCGATTGGGCCGAGATATCGACCCCGACAGGATCCCGGTGGGGTCCGACGCTGTGGCCCGGGAATTGGATGAGCTGAATGCGAAGTACCAGAGGTTGCTGGACATGCTTTACGAGAGATTGAGGCGAATCGCTGCTGCCAATCCCGGAGACATTGTTACATTGCGCCTTGTGGAGGCAATGGCTCCTCGTTCGGCAAGATCCTTCCGGCAGGAGTTCAATATGCAAGACACGACCACAGAGCACACGTACACCTCACAATATACCACAGAAAAATACGTGAGAACCTCACATACTACGGAACTTGACGGTGAAGCACCGGTCAGATCAATGACCAATGGCAAATTAACATCTCCTAAGTACACAACAAAGACTATAATTACGGACGAAGACAGACCTGATGTTCGAAAGCTAAAACGCGTCCACAGAATGTATGAAGGTCCCAATATCATCGAATCGAGGGGTATAGTGCATCCCGAAACCAGAGAAATATTGACAGTGGGCCAGGCGATCAGTATGAGAATACTTGACGTTCGCACAGGAAGACTCCTGTCTTCGCCCGACACGAGACAGACTATAACGATTGAACAAGCAGCCAAAGAAGGTCTTATTGACCCTAAGCTAGCTGCGAGGCTCACTGGCCCGTGTGGAATGACCGAAGACGGAAACGAAGTCACTCTATTGGAAGCCATACAGCGAGAACTCTATGACGCTGAACAAGGATTGTCTGATCCAGCAGAAAAAAGGATCAAGGTAACTGTACAGGGCGAAGGGCCCGGAACCCAAGGAATGAGTATCTCGGACGCGGTCAGTCGAGGACAAGTCGACCTTGACAAAGGTCTCTATAGATTACCCAATGGAAGTTACATTTCCATCGCCGAAGCCTATCAAAGAGGGTACCTTATATACAACGAGATTATCAAAATCAAATCGAGCGCGCTGTGTCTGTCGGACGCGATAAGTCAAGACTTAGTAGATAACAACGGTTGGATCTTGGATAGGAATTCGGGCGACAAATTCCAAATAGACGTTGCTATACAAAATGAATTAATCAACCCTAACGTTAGGGAAATTCTTGATCCTAAAAACGACACAAAAATAACTCTTTCTGAATCTATCGAGAAGAATATAATTAACACTAAACATTCTAAATACGTGCACAATGTTACAAAAGAGAAGCTTAGTTTCAAGGAAGCGGCGTATAAACGTTACATTTGTAAACCTATGACCCTTAAAGACGTTTGCGATAACAATTTGATGACTAACGATGGTAAAATATTTTCCCTATCCAACAGAGTTCCATTGAATATATTAGAAGCTATATCGGTCGGTATTCTCGACAGCGACAATGTTAAATGTGTAACAGATACAACGACAGGTCAGCTACTTACTTTATCGGAGGCGATAGGAGCCAAAATAATTCTTCCGGATAATAAGTTTAGGGATAATCTGACCGATGAGATATGTACTATACCGGAAGCAGTCGACCGCGGTCTTATTACTTCTGTTTCGCAAAGATCCATTTTCGATATTGACGGTTTCAGAGATCCGAAATCAGGTGAATTCGTATCGTTCAATGCTGCTTTAAGCAAAGGCAACTTAAAATATGTAAATGGTGAAACTTTCTTGAAAGCAGAAAGTGGGGATTTCGTCTTTCTAGAAGACTGCACTAAAGTGTCTATAGTTCGACCTGAAGTTTTAGAAATGTTCAACAGAAAGATAGGTGTTTACGAAAACGGTAAGGAACTTAGCGTTTTAGATGCTGTGTTCAAAAATATTCTTGATCCTAAATCGGGACATTTACTGGAAGCGACCACTAAAAAACCTATTCCTTTCAATAAAGCTGTAGAGATCAATATGATAACGCCCGAAGGTGCGGCACTTTTGAATTCTTTGTTAAATATCACTCTTACTTTGCAAACAGTTACTAAAACAGTTAAACGCTATGTGACGGTGACTAATACGACTTCAACTCAACGTACTGAAACTCTAATCACATTTGCTGAAGCTATTAGACGTGGACTTATCGATGAAAACACTCAGACCTTTACCGACCCAACCACGGGCACCGTGATGCCAATACAGCAAGCTTTGGACGAAGGTTTATTAGGGGTTGAAAAGAACGAACCACGTGTCGTTCACATATCCGATCGAGTAGCTAAAAAAGATTTAGTACCGGGACAAGTAGTAGAATTAAAAATAACGAAAAAGTCGTTTATTAAAGATCTACCTTCTAGTCCCGAAAGTAAGGTTGAGCGCGATAGTCGACCAGAAACATTAAAAAGCCCTGAATACACAGTTCGTGAGGTTAGTCAACCGCGTGAAAGTGTAGTCCAAGAAATTAGGACGGTTACTTCAAAATCTGTTGTCACTGAACCTTCGGTAACCTCAATGACCATTAAGAAAAACACCATTGAATTGCCGAGAGGAGGGTGGACTTTAAATGAAGCTATACATCTTAACTTTTTCGACCCTACTACGGGTATGTTCGTTATTCCTGGTACTGACAGAGTTTTAGACCTTGAAGAAGCCCTTAAATTAAACCTAATTAATCCTGAATCCGCAAAAGTCATTGACCCCAAAACTCGTAAAGAAATGCCATTAGATAAAGCACTCGAATTACGTTTAATTGATCATGTCGGTCGTTATAAATATATCACTGAAACTATTACAATGTTACAAGCAATAGAAAGTAAATATATTGTATTTATTCACCTAACTCAATCGGTGTCATCTCAAAAAGTTATAACGATTACATCGGTAGCCGGTATGCCAGATAAAATGGAAATTTCGGAAATATCAGACGTGACCACGTATCCACGTGACCTCGAAATAGAGGAACAAGTGGCTTTAGAACCAGTACAAGTAGCACCTGGGGTTATATTTGATCCTGCCACAGCTTTAGTCATATCTACTCCTTCTGGAGTTTCAGAGAATATAATAGAAGCTGCTTATAATGGTACTGTCGCTCCTGACACTGTTAAAGTCATTGAACCTCAGACTAGGAAATTCATAACATTGCAGCAAGCCATTGCTAAACGTATTATTGATAGAAAAACAGGGGATTACATAGATAACTCAGGAAATAAATTTACTCTAGCAGATGCTGCAAAAGTAGGTTTGATAGCTGTTGTAGGTGCACCTTTAGTTGCGGCTTCTAAAGTTATTCAGGTTGTAAGGAGTACTATGGTAGTTGATCCACAAACGGGAGAAAAATTACCGATGGAGGTAGCATATGAAAGGGGCTTAGTTGACCCTGATACGTATAAGCGCTATGAAGAAGAAATTAGAGATAGGACGTTAGAAAGCGACAAACCAAGAAGCGAACATACAACAAAAACAGAGACAATCACGGTTACTCAAACAACAAAGACATCACCGGAGGGAGCCGCTACTGTTACAGTGGTGGTTGACCCAAATACCGGGGAAAGATTACCACTTGATGTAGCTTATGGAAGAGGCCTAATAGATCCCGTTTCATACAAAAAATACGTATTGTCGGTTAGTGATCAAAAACCAGGTTCCATTACTTATCATGATATTAAGTCACCTAGTACTAGCAAAGTAACTTTCAGCCAAGCACCTCAGAACTTTGAGACTGAACCCATAAATATATCGAATAGTAAAACAGTTACTGTTTCACATTCGACCACAAAACCAATATCAGTAGGTGCAGCTGTTTCTGAAGGATTCATTACAGTAGAATCAATTCAAAATAGTCTATCTGCTGATAACAGGCGAGTGATAACAACACAGGCATTAGACAAAAAAGACAAGCCGCCGGAAGTAATTCAAATTATTAAAGCTAATTTAAAACCCAAATACAAAGTCGCTGCTGTTAGAGAAAACACTCCTGATATCCCGATAGAGTCTAAACCCGTTATTCTTCAAAAATTAAGAAAACGTGTAGTAACACCTATGGAAGCTCTCGAGAAAGCCTTAGTCGATAAAGATACAGCAAATATTTTAGAGTTGGTTAAAGCTTATAAAGATGAGAACGGCCTTCCTATTAATCTAAAAAAAGCGATTGATATCGGGTTAGTTGATGAAAACGACGGTAAATTAGTAGATCCAGTACATGGTGATACTTTAACGATTAAAGTAGCGATAAATAGAGGAATCTTAGACGGTGAAGGTCAAGATGAAGTTCTGATACCGCTTGCAAGAAGTTTAACTATTCCCGAAGTTCTTGAACAAGGGTTACTCGATCCAGTAACAGGTAAGATTATACATCCCGAGACAGGTAGCCTTTTGACACTTAGAGAAGCTTTAATTTGTGATATCGTAGATCCATTGTCAAGTGTATCTATAGCACCGGGAAAGAAAATAACCTTAACCGATGCTATTACCAGAAATATGATAGATGATAGTAAAAATTTAATTAAAACTAATGATGGTTCCATGGATTTATTAACCGCTGTCAACGCTCAAGTCTTCTCTGATGTCCAAGTAATTAAAAAAGATGAAACAATACCTCCTGCAGCAATGACTCTTAATGTTGCTATTAAAAAGAATTTAATAAATCCTCATACAGGGGAAATAAAACACCCACTTACTGGTGAATTAATTTCACTTACTGATGCCATTAACAGAGACTTGATTATGGCAATACCTTACCCTCAAACGTCTGATACTATTATTTTAGAGGATGCTTTAGAAAAAGGTGCTATAAATCTTAAACAGGGTGTCTTCATTAATCCAGATACTAAGGAAATACTTCCAATTGACAAAGCTTTGGAACAAGGACTATTGGCCATTAAAACGAACCCAATAGCTATGGAAACAAGCGGTGTGGTAACTACTATTACTGAAACATTTACATCGCAGCATACAATTACAACAAAAATGATTGAACTTCTCGCTGATTATGTATTAATCAATGCGAATGAAATAAAAAACACTAGAACCGGTGAAATCATGACTATAGATGAAGCTCGTCTTAAAGGTATTGTGAGAGATGAACAAACCAGTAAGGAACAGTTTATTACATCTGATACCAATATTAATTTTGAAGATGCGCTAAGTCACGGCTATATCAACATTGAAACCGGCACTTTCACTCATCCTAATACTGGCGAAACTCTATCAATACCAGATGCAGTTACTTCGGGAGTATTAACTACAGAAATTAAGCCAGATTCTAGTGAGCCTTCTCTGAAGAAAAAAGAGTTAGAAATGCTAGATCTAAATGAAGCATTTGAACTTCTGTTTGATGAAAGAACGCAAAAATTCAAGGATCCCAAATCACCTCACAAACTAATATCATTCAAAGATGCTCTTGCTAAGAAAATTATAGATCCTGAATCTGTAATATACAATGTAGAGGCTGCTAAACCAGTTACTTTACAAGAAGCTGTAAAAATAGGGCTTATTGACATCAAAACAGGACAATTAAAAGAACCTAAAACAGGTAAATTGGTAGATATAAAGAAAGCTGCAAAAATTGGGCTAGTCGCTGTGATCGCAGCTCCTGTACTCGCTGGTATGGCAGTAGTACAGGGAGCTCAAGCGGTGAAAAGTAAATTGATGCAACCAAAGCAAGACAAGGTGTTTGAGGAACCAAGTAGAATTGTGTCCGCTGATAAAGCGACTGTTGACAAGGTTACAGAGCCTAAAAAAGTAATTCAACGTAATATTGAAGTAGAACCAAAAGTGAAAGATGCTAAAGTAAGTGTTAAGGATATTCCGTCGCGGCCTAGCATATCCGAGGATCCTAAGAAAGATGTCAGTAAAGAAAAACTAAAAACGGAAATTACTCCTACAGAAAAAAGGGAAATTGAAACTGAAACTGCCGTAGCATCATCAGCGGAAAAACAGGTTATAACTTCTGCCAACCAACCATCATCAATAACTACGAAGCCTGAACATCAGATAGCTACCTCAGTGCCAAGTAAAACTAGTATCAAGCACGAAGAGCAAGTTCTTGAATCATCTAAAGTGTTAGAAAAAAATATTATTGATCTCAAAGAAGTTGTTGAAACATGTCAAAAGGTCAAATACGGTACTAAACCTGAAAATGAGAAAACGCAAATGACAGTAACCGAGAAATTAACTACAGAACATATTAAACAAGCCCCCAAGCATGACAAACCAATTTCAGGACAAGAAATGGATATAGTGAAACAAAAAGATAGTCATGAATTAAATGACGAAGATACGGCGAAACAAAATCCTGAGCAGTCAACCCCAAGAGATGAAGGAACAAGAATTACAAAAACTACAATTACAAAAACAGATCCATCCAAGTCTTCATTACAGACGACTAGCACAATAACAGCTACTAAGACATCAACTGTGACAACAATAGAGGTCACTCAAAGTGCATCTTCATACAAGATCAGTCCTGAAGATTACGAATCTGAGGTCACTATTGAAGAAATTGATAGTGAACCTTACCAATCTTCACAAGTGCTTGATAAAGAATATACTACGGATGTTTCTAAAGATCGTTATGAAATAACAACTGAAGATGTATCTCCCAAAGACATAATCAAGTCTAAACCTATTGATGAAGCTTCTATAAAACAGAAATCACCCGAAGTAGAAACAAAAATAGCTGAACCTCCCAAAATTATCGAAGTGACCGAGGGTGTTATTTTTGATCCTAAAACATCTTTGGTTATTTCAGAAGCTATTGGAGTGTCTGGAGATTTGTTAGAAGCTGTAAATAAAGGTGTCGTTCCATCTCAGAATGTTAAAGTTGTAGATCCGAAAACAGGTGTTCAGATTTCACTCCCAGAAGCTATTAAAAAAGGTGTTGTCGACGAAAAAACTGGCAAAGTGAAAGACACAACAGGGAAAAAAATTAGTTTCGCAGATGCAGCGAAGTTGGGGCTTGTAGCCGTTGTGGGTGCACCTATTTACGCAGCATCTAAAGTAATTGAAATTGTTAAAAATGCAGTCGTAGTTGATCCTAAAACTGGAGAAAAATTGCCTATAGATCAAGCTCGTCAACGCGGCTTAATTGACTCACAGGCTTATGGCAAATATGAAGAGGTTATAAAAAGTAATACTTGTCAAGATATTACTACTTCTCAGGTTACTGAATATATCAAAACAGTAGTAGTCGTCGATCCGAAATCAGGCGAAAAATTATCCATAGATGATGCTTATCAGCGTGGACTTGTTGAACCCGATGTTTATGAAGAGTACAAAAAATCTGGGCAAATTGCAAATACTGAAGGATTAGTTTCTTCAACAGAAACTAGTCCTAAAAGGGAAATTTTGCAGCCAAGTTCGATTGACGAATCTTCTTTGATTATACGACAAGGTACTATGACCGTAACTGACATCGTCAAAACGGTCATTGTAGATCCTAAAACCGGTGAACAAGTAACTTTAGAGGAAGCCCTTAACCGTGGTTTAGTTAACCAAAAGGAGTATGACACATTACAAGATACTGCCAAATCTTATAGTCCACAAAATATAGTTGTATCAAAAACTTCAGAAACAAAATCATTCCTTATTGAAGATCCTAAATCAGGTAAGAAATTGAAATTAGACGAGGCACTTGAACAAGGTATAATTGACTCTGATACTTATGAAACATATGAAGATTCTTCTAAGTCGTACGATGTCAGAGATGTATATGTTATTGATCCTAAAACAAACGAGAAGTTACTATTAGAAGACGCTTTAAAACAGGGTGTCATTGACTCTGAGAGTTACGAGAAGCTTAAAGATAATACAGATCACCAACAAGTATCACATGAAACTAAAGTTATTAAAACCATTCTCATTAAAGATCCACAAACAGGTGAAAATATGTCTTTGGAGGAATCTTTAAATAGAGGTGTTATAGATAAAGACACATATATAAAATATAACGAAGTATTAAAATCTAACAATCCTGAAGATTTGATGCTTCTGCAACGTCTTAAGGATTTTGATATAACAGTCACCGAACAGATTGTACAACACCAAGTAATAACTAAAACTACAACCAAGGCTGGAGAAATAATAACAAGTAAAAAAATTGAATATGAACCGACCATTTCTATAGAACAAAAAGTCTCCGAGTTCGAAGGTCCAATTCAGACAGTTGTTAAGGACGGTAAGACCGTATCTGCCATGTTGATTGATGCCGAACGACAACCCTTAAGGGTAATTGATGAAATAACTGAACAAAATGTAACGAAAGAGAAACCGACTCCTGTTAAACCATTATATGAAAACGTAACGCTCATCGATGCTATTGCTCAAGGTAAAGTGGAGCCTAAAATTTGTAGGATTATCATAAACGGAGTTGAATCTCCACTTACTGTTCAAGACTCTCTTGAACAGGAACAGATAAGCCGATTTGTACAGGTTGATGTACTGTCTAAAAATTGTGTAGTGTTGAAAGAGACCAAACCCACTTACTGTGTCGCTATATCTCAAAGATTAACCCCAGAAGAATTATCAGAAATGGGCGTATATGATATTGAGAAAGGTATTTTCTTAAATCCTGAAACAGGGGCTAAGATATCCTTTGAAGAGTTGGTTTATAGCTTACAAATATTCGATCCCGAGGCTATATTAGTTAAAGATTTAAGTTCTAAATCGGACGATTACATTTCATTTGATGAAGCTATCGCTAGACCTATAATTGATAAAACCACAGGTCACATGGTCAATCCGAAAACCGGTAAACGCGTGCCCTTCTTAGAATGCGTTCAATTGCGATGGATTGTAGAGAAACCTGATGATGTTTCAATAACGGAACAGGTCACAATTGAATCCGCGCTAGAACAAGGATTATATAATGCTCAGACAGGTGTAATAAAAGATGTTAATACTGGTGCCTTAGTGCCTATAGGTGAAGCGGTGCAAAAAGGCTTGATAGATCATGAGTCTTTGTTAATCACCGTACCGCGAACTAATGAATTAGTAACTCTCTCAGACGCAATAGAGCGTGGTATACTCGAAATTCACGACGGGGTTATCACTATTATTGAGACGCAAGAAATCATTGAAATATCTGTTGCTATCCAACGCGGTTTGATTACTATCATCCGACGGGCTGTTTCTATTGAAGCAATTATAAAGAGCCAAATGTATGATTCCAAAACGGGAAAAGTTAAGGATATTTTGACTGATCAATTAATTACTGTACGCGACGCGGTAGATAGGAACATAGTTCATCCAACAATATCTGAAGTAAAAGATACGGGAACCGATAAATTCCTACCATTAGGAGATGCTCTTGATGTAAAACTCGTTGATCCAATAACAGGGAAATTAAAAGACAAAAAGACTGGTAAATACATTCCATTAGACGATGCATTAAATAAAGGATTGGTTGCTACTAAATCTGTTACTTTCACTTTGTTCGATATCATCGAATTAGGTTACTATACACCTGAAAATGGACAAATTCTAAATCCGATATCGGGTAAAATTATAACACTGAAGAAAGCTATTCACGAGAAACTTGTAGATCCTACCGAGATACAAATTAAAGATGATAAGTCAGAGGCAGTTGTATCGTTCGATAAAGCTGTACAGTCTGGCCTGATAGATCTTGAACAAGGAATAATCACGTCACCAGTTATGAACCTTAAAGATGCGTGTGATAAGGGTTATCTTCTTAGCGATAAAAAACCATGGACATTACAAGAAGGTCTCGTACAAGGATTTTACGATCCTGGAACGGGTCTTTTGACAATTAATAATATTACAATGACTTTAGAAGACGCTATCAAAATTGGTAATATAAATCCAGAAGCTTTGACTGTAAGAAATGCAATAACGGGGGAAATTATTTCATTGTCAGACGCTATCAAAGTAGGAATAATTGACTCTAAAGAAGGTAGGGTTAGAGATCCGGTTCACGGGGATAAAATATCCCTTACAGATGCCGCCGAACGTGGTTTAATTGTACCCGCCAAACGAAAATTAAGTTTGCCAGAAGCAGTATTTAAGGGTTTCTACGATCCAAAAACTGGTAAATTTTCACATCCTCAAAGTAAAGAGAAAGTGCCCACTGATAGGGCAATAAGGAAACGAATGATAGATCCTCAGTCAACTTTGGTACACTTTGCTGGTAAAGTAATTCCGTTTGAATTCGCAGTAGACAGAGGTATTGTAGATAGCAGAACAGGTACTATATTTGTAGGCGATGAAAAAATTGACTTCCGTGAAGCTTTTGAAAGGGGGGTTTTAGTTGAAGTTCGTAAACCTTTATCGCTCGTTGAAGCTATTGAAAAGGGTGTTTATAATGAAATATCTGGACTGTTTATGGATCCACAAACTGGTAAAAAGTACACTCTTACTGAAGCAATTAAACTTCATTTGATCGATCCTCATTCAGTGCACATTCAAGACAATAGATTAGGTAAATGGGACAAGTTGTCATTGCCAGAGTCCTTAGAAACAGGAGTCATAGATGATCAAAGTGGTAAGATCAGAAATATAAATAATGACAATGAAGAAATTTCTTTACGCAAAGCATTTGAAATCGGTCTCCTTGTTGATAGTAAAGCACCAATAAGCTTGCAAAGAGCATTGCATCAAGGACTTTACGATGATGCGACCGGTAAATTTATTGATCCAACTAGTAATCGTAAAATTACTCTTCATGAAGCTATTAGGAGGTCAGTCATTAGTCCGAAGTATCTATGCTACTTCGACAAAAAATCTGAAAAACCTTTGTCTCTTGGCGAGTGTTGCCGTAACGAAATTATTGATAGGAGAAGTGGCAAGTTCCACGAACCAGGTTCCGATGTCCAGATACCCTTATCTGAAGCCATGAGTCTAGGATTAATCGTGGATATTGAAAGTGCTGGCTTCACTTTGTACGACACATTAGCCATGAACATGTATAACATAACAGAATTAATATTTATTCATCCGGTAACGGAACGTAAAATAACACTTAATTTAGCAATAGCTGAAGAGCTCATAAATCCTGAAACTTCCTTGGTAAAACATATACCGTCTAGCAAATATATTAAATTGACTGAAGCCATCGAAAGCGGTATAGTAGACGATGAAAACAATATTTACGTTCTACCTAACGGCAATCAAATCAATTTGTTAGATGCTAAACATCGCGGCCTTGTGGTAACGACAAAGAAAAATCTTAGCCTAGAAGAAATAATTAGAAACGGCTTATTTAGAGCGGATAACGGCAAAATCGTTGATCCATGCACAAATGAATTCATTGATATAAATAAAGCTATCGACATTGGTCTCCTCAATCCGGAACTTACAGTTGTTAAAGATAGTTTTACGAATAAATACAAACCGCTTTTATTGGCTATTCAACAAGGTGATGTTGATGTTGCAAAAGGCAGGGTACTAGATACAAAAGCAAAGAAAACATTTAGCATTGACACTGCGTTCGATAAGGGTTTGCTCGTGACTGTTATACAGCCAATTACTTCTCAAACAATATCTAGAAAATTCGTGTCAGATAGTGCGGCCTATAAACAACCCATGCTTAGGGAATTTTCTCTTGATGAAGCTATCAAGTATGAATTTATTGATCCAGAAACGGCCGTCATAAAAGATCCCCATAAGAATAAATACATTCCACTTAACCTAGCTATTACTGAAGGTATTATTGACAAAAATGCGAAGGGATCTTTCGATACTCAGAATAGGTCGCGCACGCTTTGTTTCGTTTTTGAAAACGGTTTAATTGTGTACGTAAGAGAGCCTCTTACGTTCGAACAAGCGCTCGAAAAGGGTTACCTTAACGTTAGCACCGCTCGATTTACCGATCCATCCTCCAACGAAGTGCTCACGATTAAAGACGCAACCACACTTGGGTATATTGATGCAGACACAGCGCTCATCAAAGATAATCTCAAAAAGAGGCTAACTAAACTTCCGGAAGCTTTCCGTAAGGGTTTCATGGACGCTGAAAAAGGCAATATATTAGACACTGAGACCTCAAAACTTAATACATTATCTGCTGCAATCGAAAGCGGTCTACTCATGACGCCAAAGAAGAGCTTCACCTTAATCGAAACTCTAAATTTCGGTATCTACAATCCTACTACCGGTGCCTTGAACGATCCATTCATTACTACCAGCGTTATCGATAGAAAGAGGCTTAATTTAGACGAAGCGATCCAACAAGGAATCGTTGATCCGTCAAGCACAGTTGTCAAGGAACCGGAGACCGGAAAGATATTGCCATTGGTTCAAGCTATAGAACAAAGGTTGGTTGATCCCGTTGAAGGCAGACTCACGATTGATGCAAAGAAAGGGATCAGTCTTGATTTAGTCAAAGCCCTAAAGAAGGGGTATTTGCTGCCAGCAGAAACGAGGCAAGCAGTAGAAGAGAAATATAGGCTTTGCGACGACACCCTGTCGAAATTGCTCGAATGGATCGGCAATGTTGAGGACCGATTAGCCAACCAAGAGGCAGTAAAGGAAGATATCGATGAACTACGTAACCAGATAAATACATTGAAGTCGATCAAGGATGACCTTGAGGGTCACCAGCGTCAAGTATCCGCTTGCGCAGACCAGGCCAAGCAACTCCTCGTGTCCGGAGGCGACGTGCTTGCTCCACATGAGGTATGTTAA
Protein
MYGSGFAQAETLGTGAGTNAGLACDTEGAEALMSGPEARRRVNPSVDETGARSTSISESESEDEQAGAGDLRVGVLEGATEAADDRAAGMVTTADDAAVLLASIGDAGTAGTTEAAVLDAEALHAGTGDAGAASAAEDIKQTESGLDSVERHIEGELRRVERGVHPADAKTAAEQIEHDLRAMELALHEMFQDANALREGRYPQANELHRRVQQLQERWALARQALASRLVPRLAGVRMPVQHTTVRRETRTVLETRVHDADPRFHQLADAAAWCRDKLKKLHESEYGSDLPSVLHELDKHQREHKLIDQFHSKVEQCVHNRSNFNGEELNLYNQHLSQLQKLYAELLSTSTKRMSDLDALHDFLQSATAELNWLNEKEQVELSRDWADPHINLPAVQHYYEQLMSSLEKRELQFSNVIDRGEALIAQHHPATKTIESHLQVMQSQWAWVLQLTLCLETHLKHTTQYHTFFEEIKEAEKWIAKREEALNTTFSQSEFTLDQGERLLKGMQDLREELNTHGAAVSRLVEEAQEVRPVKLRRAPVTRPIRAETVCAYKHANVAIEKGASLSVVDNSGRSRWRVRLGGAGSEAQVPGAVLALPPPCRDALAAADALRAQLDRVIHLWQRKQLRMRQNMIFATIKVVKGWDFPQFVAMGAEQRQAIRRALNEDAEKLLAEGDPADPQLRRLRREIDDVNRLFDEFERRARAEEESKNAARIFTEQSTHLLERLEVLERQLHERIASHIPRDLDSLEHLVLQHKDWEGNLHALSGDVEEAQSTFRGIALKTPAMKKSLDKVMGKWNDLHSKSQLFVERLKFVEIVVNSVEENHQVISEFEIKLAQFSDLPNDIEILKDIHEDLLRMQVAVSKQQIQVDQMNDDAENCRRLVHASRDALPHSSLPRAGKHQDLERLDKEVAQLNARWSNVCTQLAERLRSCEAAYQLLRNYNAGLEKEAEWIDDAYKRLQAQPPVEVRPKEQFEPTRNLLTSVVERTPKIEKVNVDGGRFIREAKINSSRCQRYTEWLCEEVHPSLDVRHLRRQADLDQAERIRRLGRDIDPDRIPVGSDAVARELDELNAKYQRLLDMLYERLRRIAAANPGDIVTLRLVEAMAPRSARSFRQEFNMQDTTTEHTYTSQYTTEKYVRTSHTTELDGEAPVRSMTNGKLTSPKYTTKTIITDEDRPDVRKLKRVHRMYEGPNIIESRGIVHPETREILTVGQAISMRILDVRTGRLLSSPDTRQTITIEQAAKEGLIDPKLAARLTGPCGMTEDGNEVTLLEAIQRELYDAEQGLSDPAEKRIKVTVQGEGPGTQGMSISDAVSRGQVDLDKGLYRLPNGSYISIAEAYQRGYLIYNEIIKIKSSALCLSDAISQDLVDNNGWILDRNSGDKFQIDVAIQNELINPNVREILDPKNDTKITLSESIEKNIINTKHSKYVHNVTKEKLSFKEAAYKRYICKPMTLKDVCDNNLMTNDGKIFSLSNRVPLNILEAISVGILDSDNVKCVTDTTTGQLLTLSEAIGAKIILPDNKFRDNLTDEICTIPEAVDRGLITSVSQRSIFDIDGFRDPKSGEFVSFNAALSKGNLKYVNGETFLKAESGDFVFLEDCTKVSIVRPEVLEMFNRKIGVYENGKELSVLDAVFKNILDPKSGHLLEATTKKPIPFNKAVEINMITPEGAALLNSLLNITLTLQTVTKTVKRYVTVTNTTSTQRTETLITFAEAIRRGLIDENTQTFTDPTTGTVMPIQQALDEGLLGVEKNEPRVVHISDRVAKKDLVPGQVVELKITKKSFIKDLPSSPESKVERDSRPETLKSPEYTVREVSQPRESVVQEIRTVTSKSVVTEPSVTSMTIKKNTIELPRGGWTLNEAIHLNFFDPTTGMFVIPGTDRVLDLEEALKLNLINPESAKVIDPKTRKEMPLDKALELRLIDHVGRYKYITETITMLQAIESKYIVFIHLTQSVSSQKVITITSVAGMPDKMEISEISDVTTYPRDLEIEEQVALEPVQVAPGVIFDPATALVISTPSGVSENIIEAAYNGTVAPDTVKVIEPQTRKFITLQQAIAKRIIDRKTGDYIDNSGNKFTLADAAKVGLIAVVGAPLVAASKVIQVVRSTMVVDPQTGEKLPMEVAYERGLVDPDTYKRYEEEIRDRTLESDKPRSEHTTKTETITVTQTTKTSPEGAATVTVVVDPNTGERLPLDVAYGRGLIDPVSYKKYVLSVSDQKPGSITYHDIKSPSTSKVTFSQAPQNFETEPINISNSKTVTVSHSTTKPISVGAAVSEGFITVESIQNSLSADNRRVITTQALDKKDKPPEVIQIIKANLKPKYKVAAVRENTPDIPIESKPVILQKLRKRVVTPMEALEKALVDKDTANILELVKAYKDENGLPINLKKAIDIGLVDENDGKLVDPVHGDTLTIKVAINRGILDGEGQDEVLIPLARSLTIPEVLEQGLLDPVTGKIIHPETGSLLTLREALICDIVDPLSSVSIAPGKKITLTDAITRNMIDDSKNLIKTNDGSMDLLTAVNAQVFSDVQVIKKDETIPPAAMTLNVAIKKNLINPHTGEIKHPLTGELISLTDAINRDLIMAIPYPQTSDTIILEDALEKGAINLKQGVFINPDTKEILPIDKALEQGLLAIKTNPIAMETSGVVTTITETFTSQHTITTKMIELLADYVLINANEIKNTRTGEIMTIDEARLKGIVRDEQTSKEQFITSDTNINFEDALSHGYINIETGTFTHPNTGETLSIPDAVTSGVLTTEIKPDSSEPSLKKKELEMLDLNEAFELLFDERTQKFKDPKSPHKLISFKDALAKKIIDPESVIYNVEAAKPVTLQEAVKIGLIDIKTGQLKEPKTGKLVDIKKAAKIGLVAVIAAPVLAGMAVVQGAQAVKSKLMQPKQDKVFEEPSRIVSADKATVDKVTEPKKVIQRNIEVEPKVKDAKVSVKDIPSRPSISEDPKKDVSKEKLKTEITPTEKREIETETAVASSAEKQVITSANQPSSITTKPEHQIATSVPSKTSIKHEEQVLESSKVLEKNIIDLKEVVETCQKVKYGTKPENEKTQMTVTEKLTTEHIKQAPKHDKPISGQEMDIVKQKDSHELNDEDTAKQNPEQSTPRDEGTRITKTTITKTDPSKSSLQTTSTITATKTSTVTTIEVTQSASSYKISPEDYESEVTIEEIDSEPYQSSQVLDKEYTTDVSKDRYEITTEDVSPKDIIKSKPIDEASIKQKSPEVETKIAEPPKIIEVTEGVIFDPKTSLVISEAIGVSGDLLEAVNKGVVPSQNVKVVDPKTGVQISLPEAIKKGVVDEKTGKVKDTTGKKISFADAAKLGLVAVVGAPIYAASKVIEIVKNAVVVDPKTGEKLPIDQARQRGLIDSQAYGKYEEVIKSNTCQDITTSQVTEYIKTVVVVDPKSGEKLSIDDAYQRGLVEPDVYEEYKKSGQIANTEGLVSSTETSPKREILQPSSIDESSLIIRQGTMTVTDIVKTVIVDPKTGEQVTLEEALNRGLVNQKEYDTLQDTAKSYSPQNIVVSKTSETKSFLIEDPKSGKKLKLDEALEQGIIDSDTYETYEDSSKSYDVRDVYVIDPKTNEKLLLEDALKQGVIDSESYEKLKDNTDHQQVSHETKVIKTILIKDPQTGENMSLEESLNRGVIDKDTYIKYNEVLKSNNPEDLMLLQRLKDFDITVTEQIVQHQVITKTTTKAGEIITSKKIEYEPTISIEQKVSEFEGPIQTVVKDGKTVSAMLIDAERQPLRVIDEITEQNVTKEKPTPVKPLYENVTLIDAIAQGKVEPKICRIIINGVESPLTVQDSLEQEQISRFVQVDVLSKNCVVLKETKPTYCVAISQRLTPEELSEMGVYDIEKGIFLNPETGAKISFEELVYSLQIFDPEAILVKDLSSKSDDYISFDEAIARPIIDKTTGHMVNPKTGKRVPFLECVQLRWIVEKPDDVSITEQVTIESALEQGLYNAQTGVIKDVNTGALVPIGEAVQKGLIDHESLLITVPRTNELVTLSDAIERGILEIHDGVITIIETQEIIEISVAIQRGLITIIRRAVSIEAIIKSQMYDSKTGKVKDILTDQLITVRDAVDRNIVHPTISEVKDTGTDKFLPLGDALDVKLVDPITGKLKDKKTGKYIPLDDALNKGLVATKSVTFTLFDIIELGYYTPENGQILNPISGKIITLKKAIHEKLVDPTEIQIKDDKSEAVVSFDKAVQSGLIDLEQGIITSPVMNLKDACDKGYLLSDKKPWTLQEGLVQGFYDPGTGLLTINNITMTLEDAIKIGNINPEALTVRNAITGEIISLSDAIKVGIIDSKEGRVRDPVHGDKISLTDAAERGLIVPAKRKLSLPEAVFKGFYDPKTGKFSHPQSKEKVPTDRAIRKRMIDPQSTLVHFAGKVIPFEFAVDRGIVDSRTGTIFVGDEKIDFREAFERGVLVEVRKPLSLVEAIEKGVYNEISGLFMDPQTGKKYTLTEAIKLHLIDPHSVHIQDNRLGKWDKLSLPESLETGVIDDQSGKIRNINNDNEEISLRKAFEIGLLVDSKAPISLQRALHQGLYDDATGKFIDPTSNRKITLHEAIRRSVISPKYLCYFDKKSEKPLSLGECCRNEIIDRRSGKFHEPGSDVQIPLSEAMSLGLIVDIESAGFTLYDTLAMNMYNITELIFIHPVTERKITLNLAIAEELINPETSLVKHIPSSKYIKLTEAIESGIVDDENNIYVLPNGNQINLLDAKHRGLVVTTKKNLSLEEIIRNGLFRADNGKIVDPCTNEFIDINKAIDIGLLNPELTVVKDSFTNKYKPLLLAIQQGDVDVAKGRVLDTKAKKTFSIDTAFDKGLLVTVIQPITSQTISRKFVSDSAAYKQPMLREFSLDEAIKYEFIDPETAVIKDPHKNKYIPLNLAITEGIIDKNAKGSFDTQNRSRTLCFVFENGLIVYVREPLTFEQALEKGYLNVSTARFTDPSSNEVLTIKDATTLGYIDADTALIKDNLKKRLTKLPEAFRKGFMDAEKGNILDTETSKLNTLSAAIESGLLMTPKKSFTLIETLNFGIYNPTTGALNDPFITTSVIDRKRLNLDEAIQQGIVDPSSTVVKEPETGKILPLVQAIEQRLVDPVEGRLTIDAKKGISLDLVKALKKGYLLPAETRQAVEEKYRLCDDTLSKLLEWIGNVEDRLANQEAVKEDIDELRNQINTLKSIKDDLEGHQRQVSACADQAKQLLVSGGDVLAPHEVC

Summary

Description
Interlinks intermediate filaments with microtubules and microfilaments and anchors intermediate filaments to desmosomes or hemidesmosomes. Could also bind muscle proteins such as actin to membrane complexes in muscle. May be involved not only in the filaments network, but also in the regulation of their dynamics. Structural component of muscle. Isoform 9 plays a major role in the maintenance of myofiber integrity.
Cytoskeletal linker protein. Acts as an integrator of intermediate filaments, actin and microtubule cytoskeleton networks. Required for anchoring either intermediate filaments to the actin cytoskeleton in neural and muscle cells or keratin-containing intermediate filaments to hemidesmosomes in epithelial cells. The proteins may self-aggregate to form filaments or a two-dimensional mesh. Regulates the organization and stability of the microtubule network of sensory neurons to allow axonal transport. Mediates docking of the dynein/dynactin motor complex to vesicle cargos for retrograde axonal transport through its interaction with TMEM108 and DCTN1 (By similarity).
Isoform 6: required for bundling actin filaments around the nucleus.
Cytoskeletal linker protein. Acts as an integrator of intermediate filaments, actin and microtubule cytoskeleton networks. Required for anchoring either intermediate filaments to the actin cytoskeleton in neural and muscle cells or keratin-containing intermediate filaments to hemidesmosomes in epithelial cells. The proteins may self-aggregate to form filaments or a two-dimensional mesh. Regulates the organization and stability of the microtubule network of sensory neurons to allow axonal transport. Mediates docking of the dynein/dynactin motor complex to vesicle cargos for retrograde axonal transport through its interaction with TMEM108 and DCTN1.
Isoform 2: F-actin-binding protein which plays a role in cross-linking actin to other cytoskeletal proteins and also binds to microtubules (PubMed:15265687, PubMed:20937854). Plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex (PubMed:20937854). Acts as a positive regulator of Wnt receptor signaling pathway and is involved in the translocation of AXIN1 and its associated complex (composed of APC, CTNNB1 and GSK3B) from the cytoplasm to the cell membrane (By similarity). Has actin-regulated ATPase activity and is essential for controlling focal adhesions (FAs) assembly and dynamics (By similarity). Interaction with CAMSAP3 at the minus ends of non-centrosomal microtubules tethers microtubules minus-ends to actin filaments, regulating focal adhesion size and cell migration (PubMed:27693509). May play role in delivery of transport vesicles containing GPI-linked proteins from the trans-Golgi network through its interaction with GOLGA4 (PubMed:15265687). Plays a key role in wound healing and epidermal cell migration (By similarity). Required for efficient upward migration of bulge cells in response to wounding and this function is primarily rooted in its ability to coordinate microtubule dynamics and polarize hair follicle stem cells (By similarity).
Isoform 2: F-actin-binding protein which plays a role in cross-linking actin to other cytoskeletal proteins and also binds to microtubules (PubMed:16815997, PubMed:18854161, PubMed:21295697). Plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex (By similarity). Acts as a positive regulator of Wnt receptor signaling pathway and is involved in the translocation of AXIN1 and its associated complex (composed of APC, CTNNB1 and GSK3B) from the cytoplasm to the cell membrane (PubMed:16815997). Has actin-regulated ATPase activity and is essential for controlling focal adhesions (FAs) assembly and dynamics (PubMed:18854161). Interaction with CAMSAP3 at the minus ends of non-centrosomal microtubules tethers microtubules minus-ends to actin filaments, regulating focal adhesion size and cell migration (By similarity). May play role in delivery of transport vesicles containing GPI-linked proteins from the trans-Golgi network through its interaction with GOLGA4 (By similarity). Plays a key role in wound healing and epidermal cell migration (PubMed:21295697). Required for efficient upward migration of bulge cells in response to wounding and this function is primarily rooted in its ability to coordinate microtubule dynamics and polarize hair follicle stem cells (PubMed:21295697).
F-actin-binding protein which plays a role in cross-linking actin to other cytoskeletal proteins and also binds to microtubules. Plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex (By similarity). Acts as a positive regulator of Wnt receptor signaling pathway and is involved in the translocation of AXIN1 and its associated complex (composed of APC, CTNNB1 and GSK3B) from the cytoplasm to the cell membrane (By similarity). Has actin-regulated ATPase activity and is essential for controlling focal adhesions (FAs) assembly and dynamics (By similarity). Interaction with CAMSAP3 at the minus ends of non-centrosomal microtubules tethers microtubules minus-ends to actin filaments, regulating focal adhesion size and cell migration (By similarity). May play role in delivery of transport vesicles containing GPI-linked proteins from the trans-Golgi network through its interaction with GOLGA4 (By similarity). Plays a key role in wound healing and epidermal cell migration (By similarity). Required for efficient upward migration of bulge cells in response to wounding and this function is primarily rooted in its ability to coordinate microtubule dynamics and polarize hair follicle stem cells (By similarity).
Component of the cornified envelope of keratinocytes. May link the cornified envelope to desmosomes and intermediate filaments. May act as a localization signal in PKB/AKT-mediated signaling.
Subunit
Homodimer or homotetramer (By similarity). Interacts (via actin-binding domain) with SYNE3 (PubMed:16330710). Interacts (via calponin-homology (CH) 1 domain) with VIM (via rod region) (PubMed:15128297). Interacts (via N-terminus) with DST isoform 2 (via N-terminus) (PubMed:19932097). Interacts with FER (PubMed:12200133). Interacts with TOR1A (PubMed:18827015). Interacts with ANK3 (By similarity). Identified in complexes that contain VIM, EZR, AHNAK, BFSP1, BFSP2, ANK2, PLEC, PRX and spectrin (PubMed:21745462).
Homodimer or homotetramer (By similarity). Interacts (via actin-binding domain) with SYNE3. Interacts (via calponin-homology (CH) 1 domain) with VIM (via rod region). Interacts (via N-terminus) with DST isoform 2 (via N-terminus). Interacts with FER. Interacts with TOR1A (By similarity). Interacts with ANK3 (By similarity). Identified in complexes that contain VIM, EZR, AHNAK, BFSP1, BFSP2, ANK2, PLEC, PRX and spectrin (By similarity).
Homodimer or homotetramer (By similarity). Interacts (via actin-binding domain) with SYNE3. Interacts (via calponin-homology (CH) 1 domain) with VIM (via rod region). Interacts (via N-terminus) with DST isoform 2 (via N-terminus). Interacts with FER. Interacts with TOR1A (By similarity). Interacts with ANK3 (PubMed:21223964). Identified in complexes that contain VIM, EZR, AHNAK, BFSP1, BFSP2, ANK2, PLEC, PRX and spectrin (By similarity).
Homodimer or homotetramer. Interacts (via actin-binding domain) with SYNE3. Interacts (via calponin-homology (CH) 1 domain) with VIM (via rod region) (By similarity). Interacts (via N-terminus) with DST isoform 2 (via N-terminus) (PubMed:19932097). Interacts with FER. Interacts with TOR1A (PubMed:18827015). Interacts with ANK3 (PubMed:21223964). Identified in complexes that contain VIM, EZR, AHNAK, BFSP1, BFSP2, ANK2, PLEC, PRX and spectrin (By similarity). Interacts with COL17A1 (PubMed:12482924).
Homodimer. Isoform 1 interacts (via N-terminus) with PLEC (via N-terminus). Interacts with the neuronal intermediate filament protein, PRPH. Interacts with DES. Interacts with SYNE3 (By similarity). Isoform 1 and isoform 6 can homodimerize (via N-terminus). Isoform 1 interacts (via N-terminus) with ACTN2. Isoform 1 interacts (via N-terminus) with PLEC (via N-terminus). Isoform 3 interacts (via N-terminus) with COL17A1 (via cytoplasmic region). Isoform 3 interacts (via N-terminus) with ITGB4 isoform beta-4a (via cytoplasmic region). Isoform 3 interacts (via N-terminus) with ERBIN (via C-terminus). Isoform 3 associates (via C-terminal) with KRT5-KRT14 (via rod region) intermediate filaments of keratins. Interacts with MAPRE1; probably required for targeting to the growing microtubule plus ends. Interacts with TMIGD2. Isoform 9 interacts with TMEM108 (By similarity).
Homodimer. Interacts with MAPRE1; probably required for targeting to the growing microtubule plus ends. Isoform 2 interacts (via N-terminus) with ACTN2. Isoform 2 interacts (via N-terminus) with PLEC (via N-terminus). Isoform 5 interacts (via N-terminus) with COL17A1 (via cytoplasmic region). Isoform 5 interacts (via N-terminus) with ITGB4 isoform beta-4a (via cytoplasmic region). Isoform 5 interacts (via N-terminus) with ERBIN (via C-terminus). Isoform 5 associates (via C-terminal) with KRT5-KRT14 (via rod region) intermediate filaments of keratins (By similarity). Isoform 2 and isoform 6 can homodimerize (via N-terminus). Isoform 2 interacts (via N-terminus) with PLEC (via N-terminus). Interacts with the neuronal intermediate filament protein, PRPH. Interacts with DES. Interacts with SYNE3. Isoform 1 interacts with TMEM108 (PubMed:17287360).
Isoform 2: Interacts with MAPRE1, CLASP1, CLASP2, AXIN1 and LRP6 (By similarity). Isoform 2: Found in a complex composed of MACF1, APC, AXIN1, CTNNB1 and GSK3B (By similarity). Isoform 2: Interacts with GOLGA4 (PubMed:15265687). Isoform 2: Interacts with CAMSAP3 (PubMed:27693509, PubMed:27802168).
Isoform 2: Interacts with AXIN1, LRP6 and GOLGA4 (By similarity). Isoform 2: Found in a complex composed of MACF1, APC, AXIN1, CTNNB1 and GSK3B (By similarity). Isoform 2: Interacts with MAPRE1, CLASP1 AND CLASP2 (PubMed:18854161). Isoform 2: Interacts with CAMSAP3.
Interacts with MAPRE1, CLASP1, CLASP2 and GOLGA4 (By similarity). Interacts with AXIN1 and LRP6 (PubMed:16815997). Found in a complex composed of MACF1, APC; AXIN1, CTNNB1 and GSK3B (PubMed:16815997). Interacts with CAMSAP3 (By similarity).
Homodimer or a heterodimer with EVPL. Interacts with PPHLN1 and VIM. Binds to the PH domain of AKT1. Interacts with FCGR1A.
Homodimer or a heterodimer with EVPL. Interacts with PPHLN1 and VIM. Binds to the PH domain of AKT1. Interacts with FCGR1A (By similarity).
Similarity
Belongs to the plakin or cytolinker family.
Keywords
3D-structure   Acetylation   Actin-binding   Alternative splicing   Cell junction   Coiled coil   Complete proteome   Cytoplasm   Cytoskeleton   Direct protein sequencing   Methylation   Phosphoprotein   Reference proteome   Repeat   SH3 domain   Disease mutation   Epidermolysis bullosa   Limb-girdle muscular dystrophy   Polymorphism   Alternative promoter usage   Calcium   Cell adhesion   Cell membrane   Cell projection   Endoplasmic reticulum   Intermediate filament   Isopeptide bond   Lipoprotein   Membrane   Metal-binding   Microtubule   Muscle protein   Neurodegeneration   Neuropathy   Nucleus   Palmitate   Transmembrane   Ubl conjugation   Myristate   Golgi apparatus   Leucine-rich repeat   Wnt signaling pathway   Keratinization   Mitochondrion  
Feature
chain  Plectin
splice variant  In isoform PLEC-1H.
sequence variant  In dbSNP:rs200335928.
Pubmed
14672974    19468303    10556294    16141072    12200133    16330710    + More
15592455    16452087    17947660    17114649    17208939    17242355    18827015    18630941    19144319    19131326    21183079    19932097    21745462    23806337    24129315    15128297    10873583    8626512    2050743    8633055    9177781    16641100    21223964    22673903    8698233    16421571    12482924    17081983    17525332    18220336    19367720    18691976    18669648    19413330    19369195    19690332    19608861    21109228    20665883    20068231    21269460    21263134    21406692    23186163    24275569    25944712    17397861    12791251    8894687    11159198    11851880    14675180    25712130    26477546    25556389    27234031    1717441    8345227    11751855    14702039    14574404    8575775    10428034    1712022    15489334    9872452    12168954    2461961    2090522    8010969    8752219    10637308    8621649    11375975    14581450    12802069    19403692    20164846    22522446    22113475    22419821    19632184    11514586    7670468    16289082    16797530    17161423    9971739    7736575    10357897    14576348    17287360    18638474    20209123    10529403    10559237    11845288    16710414    10574462    9455484    15265687    16076900    20937854    27693509    27802168    16959974    10601340    8954775    15345747    16815997    18854161    21295697    15057822    9412476    9521878    10051401    15616553    9628581    12244133    15229321    15226441   
EMBL
AY480033    AY480038    AY480043    AC110211    AF188006    AF188007    + More
AF188008    AF188009    AF188010    AF188011    AF188012    AF188013    AF188014    AF188015    AF188016    AF188017    AF188018    AF188019    AF188020    AF188021    AF188022    AF188023    AK017743    AF260753    X59601    U96274    U96275    U96276    Z54367    U53204    U63610    U63609    X97053    AY480044    AY480045    AY480046    AY480047    AY480048    AY480049    AY480050    AY480051    AC109322    M69225    L11690    AF400226    AF400227    AK055189    AK094883    AK096713    AK295864    AL049215    AL096710    AL590005    AL137008    AL512422    AL512448    AL590037    KF458172    U31850    U31851    AF165191    AY032900    AY032901    M63618    BC016991    AB018271    M22942    X58677    U04850    AF396877    AF396878    AF396879    AC123072    AC124386    AC127433    U22452    U25158    DQ023311    DQ463750    AK051626    AK037206    AF115383    AB085694    AAK83384.1    AB029290    AF141968    AF317696    AF325341    AF325333    AF325334    AF325335    AF325336    AF325339    AF325340    AF325330    AF325331    AF325332    AL137853    AL355477    AL365277    AL442071    AL356055    AB033077    AB007934    AF150755    DQ067088    AL606932    AL606918    U67203    U67204    U67205    AC114512    AC131172    AF001691    AF013717    AF041004    AF040999    AF041000    AF041002    AF041003    AC027687    CH471112    BC114620    AB011140    AF126834    AF116523    AF116519    AF116520    AF116521    AF116522    AK014700    AF013715   
Pfam
PF00307   CH        + More
PF18373   Spectrin_like
PF17902   SH3_10
PF00681   Plectin
PF03501   S10_plectin
PF00435   Spectrin
PF13499   EF-hand_7
PF02187   GAS2
Interpro
IPR001715   CH-domain        + More
IPR018159   Spectrin/alpha-actinin       
IPR036872   CH_dom_sf       
IPR036388   WH-like_DNA-bd_sf       
IPR001452   SH3_domain       
IPR035915   Plakin_repeat_sf       
IPR005326   S10_plectin_N       
IPR041573   Desmoplakin_Spectrin-like       
IPR001589   Actinin_actin-bd_CS       
IPR001101   Plectin_repeat       
IPR041615   Desmoplakin_SH3       
IPR030269   Plectin       
IPR036534   GAR_dom_sf       
IPR018247   EF_Hand_1_Ca_BS       
IPR003108   GAR_dom       
IPR002017   Spectrin_repeat       
IPR029926   Dystonin-like       
IPR002048   EF_hand_dom       
IPR011992   EF-hand-dom_pair       
SUPFAM
SSF47576   SSF47576        + More
SSF75399   SSF75399       
SSF143575   SSF143575       
SSF47473   SSF47473       
PDB
3PDY     E-value=3.90096e-35,     Score=381

Ontologies

GO
GO:0031581   GO:0047485   GO:0042383   GO:0048471   GO:0005903   GO:0008092   GO:0016020   GO:0009925   GO:0042060   GO:0043292   GO:0016528   GO:0005925   GO:0005829   GO:0008307   GO:0003779   GO:0005737   GO:0030506   GO:0007584   GO:0045111   GO:0005198   GO:0030056   GO:0016324   GO:0045104   GO:0005200   GO:0005856   GO:0030496   GO:0007010   GO:0043034   GO:0030855   GO:0007565   GO:0045296   GO:0070062   GO:0003723   GO:0005886   GO:0015629   GO:0008022   GO:0015630   GO:1904115   GO:0042803   GO:0031122   GO:0000226   GO:0005509   GO:0009611   GO:0030424   GO:0008017   GO:0031673   GO:0005882   GO:0005635   GO:0005938   GO:0005789   GO:0030011   GO:0008090   GO:0005604   GO:0016021   GO:0030018   GO:0048870   GO:0031252   GO:0005178   GO:0035371   GO:0007229   GO:0005634   GO:0031410   GO:0051010   GO:0007155   GO:0060053   GO:0097038   GO:0009898   GO:0007409   GO:0014069   GO:0031110   GO:0001725   GO:0046907   GO:0014704   GO:0045773   GO:0005874   GO:0030177   GO:0032587   GO:0032886   GO:0051015   GO:0051011   GO:0043001   GO:0051893   GO:0016887   GO:0016055   GO:0030334   GO:0005794   GO:0010632   GO:0008104   GO:0007163   GO:0001707   GO:0006620   GO:0070268   GO:0009612   GO:0030057   GO:0005739   GO:0001533   GO:0019897   GO:0031424   GO:0005515   GO:0006470   GO:0008138   GO:0004890   GO:0005216   GO:0043564   GO:0006418   GO:0003824  

Topology

Subcellular location
Cytoplasm  
Cytoskeleton  
Cell junction  
Hemidesmosome  
  
Stress fiber   Associates with intermediate filaments, actin and microtubule cytoskeletons. Localizes to actin stress fibers and to actin-rich ruffling at the cortex of cells (By similarity). Associated at the growing distal tip of microtubules.   With evidence from 6 publications.
Cell projection   Associates with intermediate filaments, actin and microtubule cytoskeletons. Localizes to actin stress fibers and to actin-rich ruffling at the cortex of cells (By similarity). Associated at the growing distal tip of microtubules.   With evidence from 6 publications.
Axon   Associates with intermediate filaments, actin and microtubule cytoskeletons. Localizes to actin stress fibers and to actin-rich ruffling at the cortex of cells (By similarity). Associated at the growing distal tip of microtubules.   With evidence from 6 publications.
Myofibril   Localizes to microtubules and actin microfilaments throughout the cytoplasm and at focal contact attachments at the plasma membrane.   With evidence from 5 publications.
Sarcomere   Localizes to microtubules and actin microfilaments throughout the cytoplasm and at focal contact attachments at the plasma membrane.   With evidence from 5 publications.
Z line   Localizes to microtubules and actin microfilaments throughout the cytoplasm and at focal contact attachments at the plasma membrane.   With evidence from 5 publications.
H zone   Localizes to microtubules and actin microfilaments throughout the cytoplasm and at focal contact attachments at the plasma membrane.   With evidence from 5 publications.
Nucleus   Localizes to actin and intermediate filaments cytoskeletons. Localizes to central actin stress fibers around the nucleus and is excluded form focal contact sites in myoblast cells. Translocates to the nucleus (By similarity). Associates with actin cytoskeleton in sensory neurons.   With evidence from 6 publications.
Nucleus envelope   Localizes to actin and intermediate filaments cytoskeletons. Localizes to central actin stress fibers around the nucleus and is excluded form focal contact sites in myoblast cells. Translocates to the nucleus (By similarity). Associates with actin cytoskeleton in sensory neurons.   With evidence from 6 publications.
Membrane   Localizes to actin and intermediate filaments cytoskeletons. Localizes to central actin stress fibers around the nucleus and is excluded form focal contact sites in myoblast cells. Translocates to the nucleus (By similarity). Associates with actin cytoskeleton in sensory neurons.   With evidence from 6 publications.
Endoplasmic reticulum membrane   Localizes to actin and intermediate filaments cytoskeletons. Localizes to central actin stress fibers around the nucleus and is excluded form focal contact sites in myoblast cells. Translocates to the nucleus (By similarity). Associates with actin cytoskeleton in sensory neurons.   With evidence from 6 publications.
Cell cortex  
Cell membrane  
Sarcolemma  
Golgi apparatus   The phosphorylated form is found in the cytoplasm while the non-phosphorylated form associates with the microtubules (By similarity). Localizes to the tips of microtubules (PubMed:27693509). Associated with the minus-end of microtubules via interaction with CAMSAP3 (PubMed:27693509). APC controls its localization to the cell membrane which is critical for its function in microtubule stabilization (PubMed:20937854).   With evidence from 14 publications.
Ruffle membrane   The phosphorylated form is found in the cytoplasm while the non-phosphorylated form associates with the microtubules (By similarity). Localizes to the tips of microtubules (PubMed:27693509). Associated with the minus-end of microtubules via interaction with CAMSAP3 (PubMed:27693509). APC controls its localization to the cell membrane which is critical for its function in microtubule stabilization (PubMed:20937854).   With evidence from 14 publications.
Desmosome  
Mitochondrion  
Length:
5219
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0818299999999999
Exp number, first 60 AAs:
0.00062
Total prob of N-in:
0.00008
outside
1  -  5219
 
 

Population Genetic Test Statistics

Pi
200.397032
Theta
167.134799
Tajima's D
0.312063
CLR
0.573396
CSRT
0.458777061146943
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
31250652 WFLLFKFIDIFEDYVSPVTAAQSLLISSCKKRKGMLERTMQLCMQILTCQNGEYGPRQRDGALHMVGTLNEILVKKKFYKDEIDSLLSMYVFPEFHSPLGYMRARGCWVLHCFASIRFKSEQLLFEAVRLTVDSLLNDTDLPVKVEAAIAVQMLLTSQEKVHKILEPQVKEVTSELLKVIRETENDHIANVLQKIVPMYT 99.87 0.0
26280517 QIYADNNDDVITDVVNK 100.00 4e-10
28467696 QVISGDTVVIR 100.00 4e-10
28467696 QKDNIHDFSNPIIVAYYDVDYTK 95.65 3e-08
26280517 IIDIENATGEKPEIIR 95.83 1e-07
26822097 DWEGNIHAISGDVEEAQSTFR 100.00 7e-05
28467696 GWDEGVAK 100.00 7e-05
26280517 QQIGHVQYQIEGPK 100.00 3e-04
26280517 DIASTATYIHPYH 100.00 0.006
31250652 QEIAITPQPVYLDPNENHK 100.00 0.012
26280517 IVDITNEISQAQISYWK 100.00 0.012
28467696 IVDITNEISQAQISYWK 100.00 0.012
26280517 HAMHVEMADEAYHIGPAPSTQSYINASK 100.00 0.025
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号