SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO11846
Annotation
Gag_polyprotein_[Operophtera_brumata]
Location in the cell
Nuclear   Reliability : 2.801
 

Sequence

CDS
ATGGTTTTTACGATAAAATTTTTATCCCTACAAAAAACTGAACTGGAATACGAAGTTGCGATAAGAGGTGAGACCCCCGGTGCTACGGTGGCTGATCTTAGGAAACAGATTAGCAAATTAAGTCAATCTTTTCCTTCAGAAGATGTATTATGTTCTCATCTCGAACCCCTAGATGATCTTCAAGCTGTTTTGGACTTGCTGAATAAAGTCAATGCAAGTCTCGAGTCAAGCCCTACTGATAAAAGTACATTATCGCGCATAGAAAATATTTTTCATCACCTTTATCATAGGATCAACAGAATAGTGGTTGATGAAGTAGAGAAGCTGCACTCTGCTTGTAGTAAACTTTTTAAAGAATTCTACGAAAAATTCCAGAAATTAAGCAAAAAGGCAATTGATCCTCTATTAGTTGGTGTATCTAGTTCAGCATCTGCTTCTGTACCTGGCATTCAGGCACCAATTAATGTCGCTGTTACTTGTGATAGAGGTGTTACTTCAGAACTGAGTAGGCTGAAGTTCGATGGTAAGTCATGTGTTCGATCTTTTATTCAACGTGTTTACGAATTTAGCGAGGCGCGTAGCATCCCCGACTCAAAACTTCTCTCATCTGCTACAGAAATATTTACAGATGATGCGCTGCATTGGTTCAGGAGTATTAAGGACCAGGTTTCATCTTGGGATGATCTTGTTGTTCTTTTAAAAAAAGATTTTGATAAAGCAGACTATGATTACCGTTTACTTGCTGAGATTCGTGCTAGGACTCAAGGGGAAACGGAAAATATTACGATATACTTAGCTATTCTCTCGGGTATGTTTGCCCGCCTCTTAAAATCACTTTCGGAAGAGGACAAGCTTGAAATAGTATTACATAATATCCGCCCTTGCTATGCAAGCACTCTAGCCTCTGCTACTGAAATATGTAACATTGATCAATTGAGATCCTTGTGCAGGAATTATGAAATTGTTCAGTCTAGGCTCGTCCACTTTCGAGAACCATCTGCAGCGACTTCCGATACCTTGGCACCAGAATTTGCGTACAAATATGCGACCAAGGCGAAATCGACCTACGACTATAAATCTAGCTATAGTTACAACAAACAGTCGTATCAACCATTAAAAATAAACAGGAACACTAATATTAATCAAAAATATCTACACAGTATTGAAGAAAGTCATCACGATGCAAGGGAAAAATTACCCTATTGTCCTAGGTGCCGCAACAATACGCATAGTTTTAGGGACTGCACTAATACGGAAGTTTTGTGTTTTAAGTGTGGTCGCAAGGGAGTTAAGAAACCTGAGTGTTCACATTGTACTGGCAAACAGGCTCCAAAAAAACTAAATTTGCAGAATTGTAGCAAACCATTGTCCCTGGAACATGTAAAGATACACCGTACCAGCCGGGATGAATGGAAGAATTTGTTAAAAACAATTAGTTTATTTTTTAATGGCTACAAGGTTGCTTCAATTCTGCATACAAAACCAACTAACGATAAAAGACCCTATGTTAATATTAAGATACACGATTTGACAGTTTCCGGCCTTTTGGATTCAGGCTCAGCGGTTACTATTTTAGGCAACAATGCTCATAGTGCATTAGTTAGTCGTGGGCTGGAGTTGTGTACTGATGATAAATTGACTATTATTGCGGCTGGTGGACAAAATTTTAGAAGTATAGGCTATATTAATATGCCAGTGCATTTCGAAAACCAGTTCCACATTATTCAGAGTCACGTAGTTCCAGAAGTTCAATCATCGCTTATTTTAGGGATTGACTTTTGGCACACATTTAAAATTTGCCCGAAGTACTTGAGTTCTCTTCATTTCCCCGGCCCTCCATTGGCTAATTTAGATGTTGGTAGCCCAACCAATTTTTTGCGCTCGTATGATTATTTGGACGAATCACAAAAGGCCGTCGTTGACAATATTACCAAGCAGTTTGAAGAAATATCTTTTGAGCGCAAAGGACTTGGACGCACAAACTTAATTACTCACCACATCGACACGGGGAATTCTCCTCCTGTGAGACAGCGCTACTATAGGCTTTCACCAGAGAAACAGAGAATCCTAGTCGAGCAAGTAGACGAAATGCTCCAGCTTGATGTAGTTGAGCCTTGTGAGAGTGCCTGGCAATCCCCGGTATTGCTAGTCACTAAAAAAGATGGTCAGCCGCGGTTCTGCTTAGATAGTAGGAAGCTAAACTCTGTTACAAAACGCGACGCTTATAACTTACCTTACATATCGGAGATATTGGACAACTTGCGAGACGCGCGCTATCTTAGCAGTATTGACTTATCAAAGGCTTTCTGGCAATTACCAATAGCACTCGAAGATAGGGACAAGACGGCATTTTACGTTCCGGGACGAGGGACGTTACGGTTCAAGACTACACCGTTTGGTTTGACCAATGCGCCTTCTACGCAACAGCGGTTAGTCGATTTATTGTTTGGCGACATGGATCACAAGGCGTTCGCATATTTAGATGATGTGATAATAGTAAGTAGCACGTTTGATGAGCATGTTAGTCTTCTTCTTCGCGTGTTAGACAAGCTGCGCCATGCTAATCTAACAATTAATTTAGAAAAGTGTGAATTTTTTCGAAGTAAGCTTAAATATTTAGGCTATGTGGTCGACGCGAATGGTTTGCGGACTGATCCGGATAAAGTTACAGCCATTCTAAATTACCCAACTCCTACATGTCGTAAGGACTTGAAACGGTTCCTAGGCACGGCAACATGGTACCGGAGATTTGTCCCAAACTTTAGCACTATCGCAGGGCCGCTTAATAGGTTGACATCGAACAAAAAATCAACACCTCCCTTCCAGTGGACAGATGAGGCCGACACTGCGTTCAAAAAACTTAAGGAATCTTTGGTCTCTGCACCTGTTCTCTCCTGCCCAAATTACGATCTGCCTTTCGAAGTCCATACAGATGCTAGTAACTATGGGATAGGTGGTATGCTCACACAAACTATTGACGGGAAAGAGCACCCTATAGCGTATATGAGCAAGTCCTTATCGGGGGCCGAAAAGAATTATAGCATTACCGAACGTGAGACCTTAGCTGTTCTCGTGGCTCTCGAGCACTGGCGTTGCTATCTGGAGAACGGAAAGACATTTACGGTTTACACAGACCACAGCGCACTTAAGTGGTTCCTTTCCTTGAACAATCCTACGGGTAGGCTTGCACGTTGGGGAGTTCGATTATCGTCGTTTGATTTTGAAATCAAACACCGCCGCGGTGTAGACAATGTGATTCCCGACGCTTTGTCTAGAGCTGTCCCGGTCACTACTATCACTACTGCTAAATCACTCACGACTTCTAGTGATGATTGAAAGCCTTTTGAATTTAATGTAGGAGATACTGTTTATAAACGCGCTTACGTCCTGAGTGACAAAGATAAGTATTTTAGTAAGAAGTTAGCACCGAAATATATCAAGTGCAAAGTTGTCGAAAAACTCTCGCCACTTGTCTACGTTCTAGAAGACATGTCGGGTAAAAACATAGGCACTTGGCATATTAAAGACTTGAAAATATTAGGTCAACACTCATAG
Protein
MVFTIKFLSLQKTELEYEVAIRGETPGATVADLRKQISKLSQSFPSEDVLCSHLEPLDDLQAVLDLLNKVNASLESSPTDKSTLSRIENIFHHLYHRINRIVVDEVEKLHSACSKLFKEFYEKFQKLSKKAIDPLLVGVSSSASASVPGIQAPINVAVTCDRGVTSELSRLKFDGKSCVRSFIQRVYEFSEARSIPDSKLLSSATEIFTDDALHWFRSIKDQVSSWDDLVVLLKKDFDKADYDYRLLAEIRARTQGETENITIYLAILSGMFARLLKSLSEEDKLEIVLHNIRPCYASTLASATEICNIDQLRSLCRNYEIVQSRLVHFREPSAATSDTLAPEFAYKYATKAKSTYDYKSSYSYNKQSYQPLKINRNTNINQKYLHSIEESHHDAREKLPYCPRCRNNTHSFRDCTNTEVLCFKCGRKGVKKPECSHCTGKQAPKKLNLQNCSKPLSLEHVKIHRTSRDEWKNLLKTISLFFNGYKVASILHTKPTNDKRPYVNIKIHDLTVSGLLDSGSAVTILGNNAHSALVSRGLELCTDDKLTIIAAGGQNFRSIGYINMPVHFENQFHIIQSHVVPEVQSSLILGIDFWHTFKICPKYLSSLHFPGPPLANLDVGSPTNFLRSYDYLDESQKAVVDNITKQFEEISFERKGLGRTNLITHHIDTGNSPPVRQRYYRLSPEKQRILVEQVDEMLQLDVVEPCESAWQSPVLLVTKKDGQPRFCLDSRKLNSVTKRDAYNLPYISEILDNLRDARYLSSIDLSKAFWQLPIALEDRDKTAFYVPGRGTLRFKTTPFGLTNAPSTQQRLVDLLFGDMDHKAFAYLDDVIIVSSTFDEHVSLLLRVLDKLRHANLTINLEKCEFFRSKLKYLGYVVDANGLRTDPDKVTAILNYPTPTCRKDLKRFLGTATWYRRFVPNFSTIAGPLNRLTSNKKSTPPFQWTDEADTAFKKLKESLVSAPVLSCPNYDLPFEVHTDASNYGIGGMLTQTIDGKEHPIAYMSKSLSGAEKNYSITERETLAVLVALEHWRCYLENGKTFTVYTDHSALKWFLSLNNPTGRLARWGVRLSSFDFEIKHRRGVDNVIPDALSRAVPVTTITTAKSLTTSSDDXKPFEFNVGDTVYKRAYVLSDKDKYFSKKLAPKYIKCKVVEKLSPLVYVLEDMSGKNIGTWHIKDLKILGQHS

Summary

Pfam
PF17919   RT_RNaseH_2        + More
PF17921   Integrase_H2C2
PF03732   Retrotrans_gag
PF00078   RVT_1
PF00077   RVP
PF17917   RT_RNaseH
PF00665   rve
Interpro
IPR021109   Peptidase_aspartic_dom_sf        + More
IPR041577   RT_RNaseH_2       
IPR036875   Znf_CCHC_sf       
IPR005162   Retrotrans_gag_dom       
IPR000477   RT_dom       
IPR041588   Integrase_H2C2       
IPR001878   Znf_CCHC       
IPR018061   Retropepsins       
IPR001969   Aspartic_peptidase_AS       
IPR012337   RNaseH-like_sf       
IPR001584   Integrase_cat-core       
IPR041373   RT_RNaseH       
IPR036397   RNaseH_sf       
SUPFAM
SSF57756   SSF57756        + More
SSF50630   SSF50630       
SSF53098   SSF53098       
Gene 3D
PDB
4OL8     E-value=1.50313e-71,     Score=690

Ontologies

Topology

Length:
1184
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00314
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00015
outside
1  -  1184
 
 

Population Genetic Test Statistics

Pi
83.633923
Theta
139.648691
Tajima's D
-1.064035
CLR
355.595984
CSRT
0.12374381280936
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号