SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO11801
Annotation
hypothetical_protein_M513_10814?_partial_[Trichuris_suis]
Location in the cell
Extracellular   Reliability : 1.694
 

Sequence

CDS
ATGCAAGGCATCGATAAAACGGACCCACCCCCCACAGACCCATTATTTCCTCAACCTACCTCAGTATGCAGAGTAGCCATAAAACTTCCTCCCTTCTGGCCTGATCGGCCTGCAGTTTGGTTTGCTCAGGTAGAGGCACAATTCTCGATTTCAGGCATCTCCGCTGACCTGACTAAATTTAACTACGTGATTGCTCAGTTAGATACCCGAATTATTGGGGAGGTAGAGGACATTATTCTCCAACCACCACCTGAGGACAAATATGGTCGCCTCAAATCCGAGTTGATCCGTAGGTTGTCCACGTCTGAGGAGATGTTGAGTTGGGTGACCGCCGTGCTTCGCAGTTTTTACGTCATCTTAGATCATTGGCAGGAAACACCCTCACTGATGAAAATTTGCTTCGCCAGCTATGGATGCGTCGCCTCCCACAACATCTCCAAGCAATTTTGGCCGCCCAATCAGAACTCTCGCTGGACAAAGTCGCTGAGCTAG
Protein
MQGIDKTDPPPTDPLFPQPTSVCRVAIKLPPFWPDRPAVWFAQVEAQFSISGISADLTKFNYVIAQLDTRIIGEVEDIILQPPPEDKYGRLKSELIRRLSTSEEMLSWVTAVLRSFYVILDHWQETPSLMKICFASYGCVASHNISKQFWPPNQNSRWTKSLS

Summary

Ontologies

GO

Topology

Length:
163
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0533
Exp number, first 60 AAs:
0.0138
Total prob of N-in:
0.11918
outside
1  -  163
 
 

Population Genetic Test Statistics

Pi
223.556542
Theta
183.884582
Tajima's D
0.678855
CLR
0
CSRT
0.570021498925054
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号