SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO11770
Annotation
hypothetical_protein_M513_10814?_partial_[Trichuris_suis]
Location in the cell
Nuclear   Reliability : 3.808
 

Sequence

CDS
ATGCAAGGCATTGATAAAACGGACCCACCCCCCACAGACCCATTATTTCCTCAACCTACCTCAGTATGCAGAGTAGCCATAAAAATTCCTCCCTTCTGGCCTGATCGGCCTGCAATTTGGTTTGCTCAGGTAGAGGCACAATTCTCGATTTCAGGCATCTCCGCTGACCTGACTAAATTTAACTACGTGATTGCTCAGTTAGATACCCGAGTTATTGGGGAGGTAGAGGACATTATTCTCCAACCACCACCTGAGGACAAATATGGTCGCCTCAAATCCGAGTTGATCCGTAGGTTGTCCACGTCTGAGGAGCAACGTGTCAGGCAACTTGTCAGTGATGTTGAGTTGGGTGACCGCCGTCCTTCGCAGTTTTTACGTTATCTTAGATCATTGGCAGGAAAAACCCTCACTGATGAAAATTTGCTTCGCCAGCTATGGATGCGTCGCCTCCCACAACATCTCCAAGCAATTTTGGCCGCCCAATCCGAACTCTCGCTGGACAAAGTCGCTGAGCTAGCGGACAAAATTTTGGAAGTTTCGCCTGGTATGGTCGCACCTCATTCATCTGCTGTTTTCTCAGCAAGTACGTCTGCCGTCTCACCCCCTTCGTTAGAAGATATCACACGGCGTCTGGATGAGGTCACGCGTCAGCTTGCTGTGCTTACTGCAGAGCGCGGTAGAAATAGGACCCGGGATTTCTCAAACCAGCGACGACGCTCACAAACGCCTGGTAAGCTTCAAATGTGCTTTTACCATAGGAAATTTGATACTAAAGCTGTTAAGTGTATTCAACCATGTACCTGGACGCCGCCGCCATCTTCGGAAAACGACAAAAGCAGTCAATGA
Protein
MQGIDKTDPPPTDPLFPQPTSVCRVAIKIPPFWPDRPAIWFAQVEAQFSISGISADLTKFNYVIAQLDTRVIGEVEDIILQPPPEDKYGRLKSELIRRLSTSEEQRVRQLVSDVELGDRRPSQFLRYLRSLAGKTLTDENLLRQLWMRRLPQHLQAILAAQSELSLDKVAELADKILEVSPGMVAPHSSAVFSASTSAVSPPSLEDITRRLDEVTRQLAVLTAERGRNRTRDFSNQRRRSQTPGKLQMCFYHRKFDTKAVKCIQPCTWTPPPSSENDKSSQ

Summary

EMBL
KL363297    KFD48322.1    KL367555    KFD64488.1    KL367519    KFD66949.1    + More
LBMM01012479    KMQ86203.1    LBMM01013103    KMQ85816.1    KQ980726    KYN14011.1    KQ981018    KYN10257.1    LBMM01009142    KMQ88358.1    LBMM01012075    KMQ86422.1    NEVH01000707    PNF43124.1    GEZM01017686    JAV90494.1    NWSH01002598    PCG67884.1    KQ979048    KYN23218.1    LHQN01021927    LHQN01025379    KOC58628.1    KOC58659.1    KQ414987    KOC58988.1    NEVH01024424    PNF17276.1    NEVH01011195    PNF31836.1    LBMM01018089    KMQ83878.1    KQ981301    KYN43041.1    ACPB03037918    LBMM01012923    LBMM01012917    KMQ85926.1    KMQ85930.1    NEVH01013558    PNF28672.1    KK111495    EZA46390.1    MRZV01001127    MRZV01000236    PIK40395.1    PIK54731.1    NEVH01003759    PNF40011.1    GL447057    EFN86960.1    NEVH01014357    PNF27922.1    KQ434816    KZC06854.1    ODYU01011787    SOQ57731.1    NWSH01000267    PCG77880.1    KQ434784    KZC04993.1    NEVH01023981    PNF17578.1    MRZV01000025    PIK61772.1    GEZM01036621    JAV82564.1    GDQN01009305    JAT81749.1    NEVH01026435    PNF14140.1    GEDV01006140    JAP82417.1    LKEY01014428    KYN50445.1    KQ979024    KYN24351.1    NWSH01001575    PCG70822.1    AAGJ04150373    CH905996    KPU81830.1    KQ414874    KOC59935.1    IAAA01053498    IAAA01053499    LAA11042.1    CH902629    KPU75574.1    GAMC01010905    JAB95650.1    GFWV01009909    MAA34638.1    KL363340    KFD47107.1    KQ415240    KOC58703.1    LHQN01026442    KQ414593    KOC58672.1    KOC70162.1    GEDV01008183    JAP80374.1    KQ971745    KYB24749.1    GG695519    EFA13383.1    MRZV01001674    PIK36447.1    KQ971759    EFA12902.2    QOIP01000006    RLU21744.1    KQ434992    KZC13185.1    GEZM01010484    JAV94030.1    JXUM01049417    KQ561603    KXJ78027.1    JXUM01111110    KQ565471    KXJ70931.1    KQ979103    KYN22624.1    KQ971355    EFA07205.2    GBHO01008962    JAG34642.1    KQ973343    KXZ75568.1    GFWV01009910    MAA34639.1    KL367562    KFD64085.1    JXUM01031600    KQ560927    KXJ80313.1    IAAA01048245    LAA10725.1    KL367475    KFD72824.1    NEVH01026394    PNF14234.1    KQ977516    KYN02153.1    KK107653    EZA48265.1    LBMM01007548    KMQ89630.1    JXUM01107723    KQ565168    KXJ71261.1    KQ435204    KZC15052.1    KQ421206    KOF78131.1   
Pfam
PF10551   MULE        + More
PF00078   RVT_1
PF17921   Integrase_H2C2
PF17917   RT_RNaseH
PF00665   rve
PF17919   RT_RNaseH_2
Interpro
IPR021109   Peptidase_aspartic_dom_sf        + More
IPR018289   MULE_transposase_dom       
IPR000477   RT_dom       
IPR041588   Integrase_H2C2       
IPR001969   Aspartic_peptidase_AS       
IPR001995   Peptidase_A2_cat       
IPR041373   RT_RNaseH       
IPR036397   RNaseH_sf       
IPR012337   RNaseH-like_sf       
IPR001584   Integrase_cat-core       
IPR041577   RT_RNaseH_2       
SUPFAM
SSF50630   SSF50630        + More
SSF53098   SSF53098       
Gene 3D

Ontologies

Topology

Length:
281
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00386
Exp number, first 60 AAs:
0.00326
Total prob of N-in:
0.02842
outside
1  -  281
 
 

Population Genetic Test Statistics

Pi
13.214659
Theta
24.646897
Tajima's D
-1.414493
CLR
7.136108
CSRT
0.0697465126743663
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号