SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO11657
Pre Gene Modal
BGIBMGA003990
Annotation
fused_lobes_[Bombyx_mori]
Full name
Beta-hexosaminidase       + More
Probable beta-hexosaminidase fdl      
Alternative Name
Protein fused lobes
Location in the cell
Mitochondrial   Reliability : 1.129
 

Sequence

CDS
ATGATGTCGTGGGGTGATGCATTATGGCTTGGCTTGACGGCGAGATTTGCGAGGGTGGGGCGGCTGCGACGAGCCGTGCTCATGCTAGCCGCGGCCGCCTGCACCGCTGCTGCTGTACTCTACTGGAAACAGCAGACTGACGACAGCGCCAACAGACCGCTTCACTCCATGTATTCGGGCATCGAACCTCAGTGGTCTTGGTTATGTCAACACGACCGATGCGAGAGGTATCAAGCATCGGATACGACGACGCTACAGTCGCTGCAGACTTGCAACATGCTGTGCGCCTCCACCCAGCTCTGGCCACAGCCGACGGGGCCTGTCAGCCTCGCATCGGCGGCTGTGCCCGTGAGATCGGACCGCTTCTCCCTCAAAGTTATAGCGTCACCATCACGCGACGTCACCAAACACTTAAACGAAGCGTTTATCGTGATGCAAAATCACATGCGAACTTTAGAACATGGCGTGGTCGGTGAAAACCGTCGATCTGACATAGGACCCCCGCGGGACGTACTGGTGAAGGTATCCGTGAACGGATCCGGCGACCCTCGTATGCGGCTCGACACGAACGAAAGCTACAAACTCGCCTTACGGCCCTCCGGCAATTCCCTCGTCGTAGACATCACAGCGCATTCGTTCTGCGGAGCGAGACACGGCCTCGAAACACTTTTGCAGGTCACCTGGCTGGATCCGTACGCCGGATCGCTACTCATACTAGAAGCGGCAACTGTAGTTGATGCCCCTCGTTTTCCTTACCGTGGCCTGCTTCTGGATACGGCTCGTAATTTTTTCCCCGTCAGTGAGCTTCTCCGCACCATAGACGCGATGGCCGCGAACAAACTAAATACGTTCCACTGGCACGTGAGCGATTCACAATCGTTTCCGTGGAAGTTAGACAGCGCACCCCAACTGGCGCAGCACGGCGCCTACGGACCGGGCGCAGTGTACACGTCCGACGACGTGAGAACAATTGTTAAATACGCACGCATCAGAGGAATCCGGGTGCTGATGGAAATAGACACACCGGCGCACGTCGGTCGAGCTTTCGGTTGGGGTCCGGAGGCTGGCCTCGGCCACTTAGCGCACTGCATAGAGGCGGAACCCTGGAGTTCCTACTGCGGAGAACCTCCGTGCGGCCAACTGAATCCTCGCAACCCTCACATATACGATTTACTAGAACACGTCTACAGGGAGATCATTCAATTAACTGGGGTCGACGACATCTTCCACCTTGGTGGCGATGAGGTGTCGGAACAGTGCTGGGCTAAGCACTTCAATGATACGGATCCGATGGATCTTTGGATGGAGTTCACGCGACAAGCCATGCACGTTCTCGAACGAGCGAATGGGGGTAAAGCGCCAGAGCTCACTCTGCTTTGGTCATCGCGATTGACGCGCTCCCCGTACCTCGAACGCCTCGACCCAAAACGCTTTGGCGTACATGTGTGGGGCGCGTCGCAGTGGCCCGAGTCGCGTGCGGTTTTGGACGCCGGCTTCCGATCGGTGATCTCGCACGTGGACGCCTGGTACCTCGACTGCGGGTTCGGGTCGTGGCGCGACAGCTCGGACGGACACTGCGGGCCGTACCGGTCGTGGCAGCAGGTGTACGAGCACCGACCGTGGGCGACGGAAACGCCCGAGAGCGCGGCATGGCCGGTGGAGGGTGGCGCAGCGTGCCAGTGGACGGAGCAGTTGGGTCCGGGCGGGTTGGACGCGCGCGTGTGGCCCCGGACGGCAGCTCTGGCGGAGCGGCTGTGGGCAGACCGTGCCGAGGGCGCCACGGCGGATGTGTACTTGCGGCTCGACACACAGCGGGCGCGGCTGGTGGCGCGGGGGGTGCGGGCGGCGCCGCTGTGGCCGCGCTGGTGCTCCCACAACCCGCACGCGTGCCTCTAG
Protein
MMSWGDALWLGLTARFARVGRLRRAVLMLAAAACTAAAVLYWKQQTDDSANRPLHSMYSGIEPQWSWLCQHDRCERYQASDTTTLQSLQTCNMLCASTQLWPQPTGPVSLASAAVPVRSDRFSLKVIASPSRDVTKHLNEAFIVMQNHMRTLEHGVVGENRRSDIGPPRDVLVKVSVNGSGDPRMRLDTNESYKLALRPSGNSLVVDITAHSFCGARHGLETLLQVTWLDPYAGSLLILEAATVVDAPRFPYRGLLLDTARNFFPVSELLRTIDAMAANKLNTFHWHVSDSQSFPWKLDSAPQLAQHGAYGPGAVYTSDDVRTIVKYARIRGIRVLMEIDTPAHVGRAFGWGPEAGLGHLAHCIEAEPWSSYCGEPPCGQLNPRNPHIYDLLEHVYREIIQLTGVDDIFHLGGDEVSEQCWAKHFNDTDPMDLWMEFTRQAMHVLERANGGKAPELTLLWSSRLTRSPYLERLDPKRFGVHVWGASQWPESRAVLDAGFRSVISHVDAWYLDCGFGSWRDSSDGHCGPYRSWQQVYEHRPWATETPESAAWPVEGGAACQWTEQLGPGGLDARVWPRTAALAERLWADRAEGATADVYLRLDTQRARLVARGVRAAPLWPRWCSHNPHACL

Summary

Description
Involved in brain restructurization via hormonal control during metamorphosis. Implicated in N-glycan processing.
Catalytic Activity
Hydrolysis of terminal non-reducing N-acetyl-D-hexosamine residues in N-acetyl-beta-D-hexosaminides.
Similarity
Belongs to the glycosyl hydrolase 20 family.
Keywords
Alternative splicing   Complete proteome   Developmental protein   Glycoprotein   Glycosidase   Hydrolase   Reference proteome   Signal  
Feature
chain  Probable beta-hexosaminidase fdl
splice variant  In isoform B.
EC Number
3.2.1.52
EMBL
BABH01021699    BABH01021700    FJ695481    ACV89847.1    AB540233    BAJ20189.1    + More
FJ695480    ACV89846.1    EU334747    ODYU01005953    ACA30398.1    SOQ47378.1    GU984637    ADF97235.1    AGBW02005277    OWR55318.1    RSAL01000352    RVE42263.1    FJ695479    ACV89845.1    KQ459185    KPJ03244.1    JTDY01001324    KOB74197.1    NWSH01002205    PCG68909.1    JTDY01007043    KOB65498.1    KP000851    AJG44546.1    KQ460949    KPJ10484.1    AGBW02009781    OWR49928.1    JTDY01000705    KOB76153.1    ODYU01001276    SOQ37272.1    EF592539    KQ971354    ABQ95985.1    EFA06836.2    KPJ10490.1    NWSH01001413    PCG71313.1    KPJ03250.1    BT127532    AEE62494.1    KB632326    ERL92397.1    BABH01021684    GEZM01019981    JAV89483.1    LJIG01002462    KRT84478.1    CH479210    EDW32880.1    CM000071    EAL26439.2    KRT03108.1    KRT03107.1    GL441088    EFN65124.1    KK107796    EZA47639.1    KQ435007    KZC13460.1    KRT03109.1    QOIP01000013    RLU15380.1    KJ786476    AIZ97749.1    KQ981305    KYN42860.1    OUUW01000001    SPP74050.1    GL888070    EGI68067.1    SPP74049.1    GL451188    EFN79790.1    KQ978292    KYM95386.1    KQ982052    KYQ60598.1    AAAB01008807    EAA03943.4    KZ288193    PBC34036.1    GFDF01001338    JAV12746.1    KQ976455    KYM85038.1    CVRI01000043    CRK96299.1    CRK96298.1    ADTU01009908    AJWK01013083    CH933808    KRG03902.1    EDW08100.1    CM000158    KRJ99444.1    EDW90752.2    CM000362    CM002911    EDX06787.1    KMY93230.1    KMY93226.1    KRJ99443.1    GFDL01013164    JAV21881.1    KMY93227.1    GFDL01013165    JAV21880.1    CH964154    EDW79791.2    KMY93229.1    DS232017    EDS32008.1    KRJ99445.1    CH480816    EDW47584.1    GDUN01000092    JAN95827.1    KQ414860    KOC60039.1    NNAY01000660    OXU27126.1    CH902619    KPU75705.1    KPU75706.1    AE013599    AHN56149.1    KPU75704.1    AF323977    AY113418    AY061037    AAL28585.1    AAL55992.1    AAM29423.1    BT133255    AFC17499.1    AHN56148.1    CH954179    KQS62831.1    KPU75708.1    KQS62830.1    EDV35498.2    BT031185    ABY20426.1    JXUM01097258    JXUM01097259    JXUM01097260    JXUM01097261    CH940662    EDW58708.1    KRF78418.1    KRF78417.1    KRF78419.1    EDV56299.2    CP012524    ALC40696.1    ATLV01023205    KE525341    KFB48585.1    UFQS01000102    UFQT01000102    SSW99622.1    SSX20002.1    UFQT01001050    SSX28632.1   
Pfam
PF00728   Glyco_hydro_20        + More
PF14845   Glycohydro_20b2
PF01490   Aa_trans
Interpro
IPR029018   Hex-like_dom2        + More
IPR025705   Beta_hexosaminidase_sua/sub       
IPR017853   Glycoside_hydrolase_SF       
IPR029019   HEX_eukaryotic_N       
IPR015883   Glyco_hydro_20_cat       
IPR013057   AA_transpt_TM       
SUPFAM
SSF55545   SSF55545        + More
SSF51445   SSF51445       
Gene 3D
PDB
3S6T     E-value=7.64911e-95,     Score=888

Ontologies

Topology

Length:
631
Number of predicted TMHs:
1
Exp number of AAs in TMHs:
15.533
Exp number, first 60 AAs:
15.44789
Total prob of N-in:
0.73885
POSSIBLE N-term signal
sequence
inside
1  -  19
TMhelix
20  -  42
outside
43  -  631
 
 

Population Genetic Test Statistics

Pi
222.117702
Theta
166.859805
Tajima's D
0.830436
CLR
0.31086
CSRT
0.611669416529174
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号