SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO11598
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.944
 

Sequence

CDS
ATGTATGGTAGCGAAACATGGGCGGCAACCAAAAGGAACGTGCATACCATTCAAGTTGCTGAAATGAAAATGCTGAGGTCAATGTGCGGCGTGACTATGCTCAATAAAATCTGTAACGAGTACGTGCGCGGAAGCCTCGGTGTACGGGACATCACCGACAAGATGCCGGAGAGTAGCCTGAGATGGTATGGTCAAGTAAAAAATAAGCCACCTGACTACGTCAAAAATTTAGCGCTACTGCTCGACCTCCCCGGTCGGAGACCTAGAGATAGACCCAAGACAAGATGGAAGGATATAGTGCTGAAGGACAAAAGTGAATGCAATGTCGCTGACGAGGATGTCGAAGACAGAGCGAAGTGGAGGAGTAAAGTGAGGAAAGCTGACCCCACCACCATGTGGGATAAATAG
Protein
MYGSETWAATKRNVHTIQVAEMKMLRSMCGVTMLNKICNEYVRGSLGVRDITDKMPESSLRWYGQVKNKPPDYVKNLALLLDLPGRRPRDRPKTRWKDIVLKDKSECNVADEDVEDRAKWRSKVRKADPTTMWDK

Summary

EMBL
FJ265554    ADI61822.1    CU462842    CBA11992.1    JARK01001341    EYC29922.1    + More
UZAH01027842    VDO95476.1    JARK01000336    EYC38182.1    UZAH01029822    VDP08057.1    JARK01001380    EYC13251.1    UZAF01001415    UZAF01017114    VDO08263.1    VDO38063.1    JARK01001343    EYC28702.1    KZ348915    PIO65553.1    UZAH01030983    VDP13266.1    AMGM01000184    EKB47241.1    KZ451907    PKA63681.1    JARK01001560    EYB90061.1    JARK01001602    EYB87210.1    EYC29983.1    JARK01001630    EYB85649.1    JARK01001534    EYB92051.1    JARK01001384    EYC12232.1    KZ452013    PKA51585.1    KZ453539    PKA47214.1    JARK01001347    EYC25573.1    EYC25574.1    JARK01001582    EYB88451.1    EYC28385.1    JARK01001481    JARK01001420    EYB96960.1    EYC04966.1    UZAH01000306    VDO18824.1    KZ452012    PKA51786.1    JARK01001342    EYC29596.1    KZ451885    PKA66495.1    KZ451888    PKA66013.1    PKA51430.1    UZAH01000708    VDO19197.1    JARK01000281    EYC39011.1    JARK01001594    EYB87753.1    CAVP010062000    CDL96883.1    CAVP010057772    CDL94282.1    CAVP010059598    CDL95931.1    JARK01001346    EYC26232.1    CAVP010061241    CDL96703.1    KZ453102    PKA47709.1    CAVP010058665    CDL95025.1    UZAH01028345    VDO99512.1    EYC26231.1    JARK01001430    EYC03360.1    JARK01001415    EYC05905.1    KZ452023    PKA50536.1    JARK01001486    EYB96487.1    EYC03359.1    JARK01001478    EYB97301.1    PKA51832.1    JARK01001422    EYC04723.1    CAVP010061812    CAVP010061814    CAVP010061816    CDL96846.1    CDL96848.1    CDL96850.1    UZAH01033489    VDP29161.1    EYC30277.1    JARK01001351    EYC23521.1    UZAH01036764    VDP46995.1    JARK01001362    EYC18796.1    EYB88469.1    UZAH01027034    VDO87933.1    JARK01001546    EYB91138.1    UZAH01033088    VDP26174.1    JARK01001350    EYC24439.1    KZ350014    PIO64310.1    JARK01000474    EYC36617.1    JARK01000458    EYC36771.1    JARK01001392    EYC10247.1    EYC24438.1    UZAH01030113    VDP09327.1    UZAH01000951    VDO19393.1    JARK01000539    EYC36061.1    CAVP010058483    CDL94742.1    HE805490    CCH50976.1    JARK01001564    EYB89718.1    UZAH01031239    VDP14558.1    JARK01001344    EYC28222.1    EYC28221.1    JARK01001340    EYC31495.1    JARK01001428    EYC03715.1    JARK01001472    EYB97834.1   
Pfam
PF00078   RVT_1        + More
PF03372   Exo_endo_phos
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR027124   Swc5/CFDP2       
SUPFAM
SSF56219   SSF56219       
Gene 3D

Ontologies

Topology

Length:
135
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00444
Exp number, first 60 AAs:
0.00444
Total prob of N-in:
0.29253
outside
1  -  135
 
 

Population Genetic Test Statistics

Pi
131.775598
Theta
111.237912
Tajima's D
-0.259133
CLR
0
CSRT
0.302034898255087
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号