SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO11503
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.072 PlasmaMembrane   Reliability : 1.484
 

Sequence

CDS
ATGTGTTTCATCGACTACAGCAAGGCTTTTGATTGTGTCAACTGGAGTTCCTTGTGGAAGGTATTGAATGTTCTTGGTGTACCCAATCATCTGATAGTGCTGGTACAGAGCCTGTATATCTACAGTCAGGGAGTTGTCAGAATCGATGAAGCTGTGTCCCAACCGTTCTGTTTTGGAAAAGGTGTCCGGCAGGGTTGCATACTGTCACCTATACTTTTTAATGCATATGGAGAGTACATCATGCGGCAGACTTGTGAAGATTGGTCGGGAGGTGTGCGCATTGGTGGAGCTCATATTACAAATCTCCGATATGCCGATGACACGACCCTGCTAGCTGCAGACGAACCTGAAATGTCTCTTTTCTTCAGCAAAATGGAACGTATCAGCAACAGCCTAGGCCTCTCCATAAATAGATCAAAAACGAAATTAATGGTGGTGGATCGAGCAAATGTTCTAAGATTGAATGGGGCGCTTGGATTAGAGGTTGTAGACGAATTCGTGTATCTCGGGTCCTGCATCAGCAACAAAGGCTCATGTGAAACTGACGTGCGCCGACGTATCGGAATGGCTAAAAGTGCGATGTCTCAGCTACAGAAGATCTGGAAGAATAGAGGGATAGGCCTGAAAACTAAAACCAGACTGGTGCGGACTCTTGTTTTCTCTATCTTCTTGTATGGAGCTGAGACATGGACGTTGAAAGCAGCAGACCGAATGCGCATCGATGCTTTCGAAATGTGGTGTTGGAGACGCATGCTAAGAATTCCGTGGACAGCCTTTCGGACTAACGTGTCGATATTGAAGCAACTGGGCATCAAAATCAGACTGTCTACTGTATGTCTGAAGCGGATCCTCGAATATTTTGGTCACATTGCGAGGAAAGACGGCGATAACCTGGAAAAACTTATGATCACAGGGAAAGTTGAAGGCAACAGATCTAGAGGCCGCAGCCATACTCGTTGGTCCGATCAGATCCGCACCGCTTTGGACAGTACAGTGTACAGCGCGCTGCATGACGCCGTGGACAGGGGAAAGTGGAAAAAGATCCTAAAATTGAAGCTCATGGGTGATGGTGGTCACGACCCTCAGACATGA
Protein
MCFIDYSKAFDCVNWSSLWKVLNVLGVPNHLIVLVQSLYIYSQGVVRIDEAVSQPFCFGKGVRQGCILSPILFNAYGEYIMRQTCEDWSGGVRIGGAHITNLRYADDTTLLAADEPEMSLFFSKMERISNSLGLSINRSKTKLMVVDRANVLRLNGALGLEVVDEFVYLGSCISNKGSCETDVRRRIGMAKSAMSQLQKIWKNRGIGLKTKTRLVRTLVFSIFLYGAETWTLKAADRMRIDAFEMWCWRRMLRIPWTAFRTNVSILKQLGIKIRLSTVCLKRILEYFGHIARKDGDNLEKLMITGKVEGNRSRGRSHTRWSDQIRTALDSTVYSALHDAVDRGKWKKILKLKLMGDGGHDPQT

Summary

Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF03372   Exo_endo_phos
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR002138   Pept_C14_p10       
SUPFAM
SSF56219   SSF56219       
Gene 3D

Ontologies

Topology

Length:
363
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
3.52013
Exp number, first 60 AAs:
2.41546
Total prob of N-in:
0.14685
outside
1  -  363
 
 

Population Genetic Test Statistics

Pi
219.766841
Theta
147.826615
Tajima's D
1.405624
CLR
5.187837
CSRT
0.768561571921404
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号