SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO11488
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 3.12
 

Sequence

CDS
ATGTCAATTCTCGAGGAGCTAAACGTCAAGACCCGTCTATCTACAATCTGCATGCAGCGTCTCCTCAAGTACTTCGGACACGTGGCCCGACAAAATCCCGAGAACTTGGAAAAATTAATAGTTGTAGGTCACGTGGAAGGAAAGAGAAGTCGAGGAAGATTGCCAACCAGGTGGACGGACATTATCAAGGAGGCCACAAACACCAGCGTCCCGGGCGCCATTAAGCAGGCCGAATGCAGGCAGCATTGGAGGAAGCTGGTGCAAAAACTGGACCAAGGTGGTCACGACCCTCAGCAATGA
Protein
MSILEELNVKTRLSTICMQRLLKYFGHVARQNPENLEKLIVVGHVEGKRSRGRLPTRWTDIIKEATNTSVPGAIKQAECRQHWRKLVQKLDQGGHDPQQ

Summary

Similarity
Belongs to the UDP-glycosyltransferase family.
EMBL
FJ265559    ADI61827.1    RSAL01000289    RVE42931.1    KZ150366    PZC71172.1    + More
FJ265548    ADI61816.1    ODYU01004401    SOQ44236.1    FJ265546    ADI61814.1    ODYU01003523    SOQ42419.1    GAIX01008594    JAA83966.1    ODYU01001007    SOQ36619.1    FJ265547    ADI61815.1    KQ459603    KPI92872.1    ODYU01000171    SOQ34496.1    GU815090    ADF18553.1    KZ150087    PZC73751.1    FJ265552    ADI61820.1    FJ265557    ADI61825.1    KZ150088    PZC73730.1    KQ460211    KPJ16569.1    FJ265560    ADI61828.1    KQ459547    KPJ00048.1    ODYU01006805    SOQ48998.1    KQ460601    KPJ13798.1    KZ150203    PZC72267.1    MRZV01000378    PIK51329.1    MRZV01000817    PIK43880.1    MRZV01000940    PIK42365.1    MRZV01000056    PIK60437.1    MRZV01002322    PIK33998.1    LBMM01032604    KMQ81702.1    AGBW02010540    OWR48330.1    AAGJ04055194    AAGJ04073865    LADJ01058192    KPJ21589.1    KQ459984    KPJ19108.1    KL363331    KFD47330.1    AAGJ04154883    AAGJ04161766    AFYH01085122    AAGJ04021158    MRZV01000994    PIK41715.1    AAGJ04093240    KL367493    KFD69765.1    MRZV01001216    PIK39650.1    BART01031562    GAH15691.1    KL363256    KL367985    KFD50217.1    KFD59415.1    MRZV01001207    PIK39730.1    MRZV01000196    PIK55924.1    AAGJ04055057    AAGJ04021346    NCKU01008836    RWS01655.1    AAGJ04075245    AAGJ04128321    AAGJ04110738    NCKU01012182    RWS00163.1    RQTK01000685    RUS76136.1    AFYH01119920    AFYH01227396    RQTK01000625    RUS76894.1    AGBW02008213    OWR54001.1    KQ460644    KPJ13248.1    AAGJ04068581    AAGJ04149053    KQ460297    KPJ16162.1    RQTK01001364    RUS70632.1    GGMS01004979    MBY74182.1    RQTK01001448    RUS70261.1    RQTK01000011    RUS91450.1    JARK01001491    EYB95904.1    RQTK01000360    RUS81011.1    UZAH01001657    VDO19881.1    ODYU01000306    SOQ34818.1    AHAT01022938    CAVP010061241    CDL96703.1    HACG01049256    CEK96121.1    KQ977522    KYN02133.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF08320   PIG-X
PF00201   UDPGT
PF05699   Dimer_Tnp_hAT
PF00498   FHA
PF07690   MFS_1
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR027124   Swc5/CFDP2       
IPR013233   PIG-X/PBN1       
IPR040039   PIGX       
IPR002213   UDP_glucos_trans       
IPR035595   UDP_glycos_trans_CS       
IPR008906   HATC_C_dom       
IPR000253   FHA_dom       
IPR008984   SMAD_FHA_dom_sf       
IPR036259   MFS_trans_sf       
IPR020846   MFS_dom       
IPR011701   MFS       
IPR036734   Neur_chan_lig-bd_sf       
SUPFAM
SSF56219   SSF56219        + More
SSF49879   SSF49879       
SSF103473   SSF103473       
SSF63712   SSF63712       
Gene 3D

Ontologies

Topology

Length:
99
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00017
Exp number, first 60 AAs:
0.00017
Total prob of N-in:
0.13001
outside
1  -  99
 
 

Population Genetic Test Statistics

Pi
291.639168
Theta
197.737254
Tajima's D
1.494703
CLR
0.032816
CSRT
0.784810759462027
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号