SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO11475
Annotation
PREDICTED:_uncharacterized_protein_LOC106721395_[Papilio_machaon]
Location in the cell
Cytoplasmic   Reliability : 1.075 Nuclear   Reliability : 1.418
 

Sequence

CDS
ATGTATTTTAGACCATTAGCATACCATTTTCAAATCTATAACATAGATGAAACTGGCACTCGGACCTCGACAAATGAACCACCCATAGTTCTTTCAGTTAAAGTTAAGAAGGAAGTTGTAGTTATTTCCAGCAATGAACGTGGACAAACTACGACCGTCGTGAGTTGCTGCAACGCTTCTGGATCATTCGTTCCGATGGGTACACGTAAACGAAAGATTCAAAAGTCTAAGGTGTAA
Protein
MYFRPLAYHFQIYNIDETGTRTSTNEPPIVLSVKVKKEVVVISSNERGQTTTVVSCCNASGSFVPMGTRKRKIQKSKV

Summary

Pfam
PF03184   DDE_1        + More
PF05225   HTH_psq
PF03221   HTH_Tnp_Tc5
Interpro
IPR004875   DDE_SF_endonuclease_dom        + More
IPR013083   Znf_RING/FYVE/PHD       
IPR036880   Kunitz_BPTI_sf       
IPR009057   Homeobox-like_sf       
IPR011011   Znf_FYVE_PHD       
IPR007889   HTH_Psq       
IPR001965   Znf_PHD       
IPR019786   Zinc_finger_PHD-type_CS       
IPR006600   HTH_CenpB_DNA-bd_dom       
SUPFAM
SSF46689   SSF46689        + More
SSF57362   SSF57362       
SSF57903   SSF57903       
Gene 3D

Ontologies

Topology

Length:
78
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0506
Exp number, first 60 AAs:
0.03198
Total prob of N-in:
0.25437
outside
1  -  78
 
 

Population Genetic Test Statistics

Pi
257.560863
Theta
179.889024
Tajima's D
1.125318
CLR
0.443789
CSRT
0.694165291735413
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号