SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO11312
Annotation
endonuclease_and_reverse_transcriptase-like_protein_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.294 Nuclear   Reliability : 1.558
 

Sequence

CDS
ATGAAAGTTCGAAAAAGGAAAAGGGTTTTGTCGGCGATTCCCCATTCCACATTTAATGTGGATTTCAGCAATGTAAGGGGTCTACATAGCAACCTCGACGCCGTACACCACCATCTTGAGACGGCGCAGCCTGCCCTCCTTTTTCTGACGGAGACGCAGATATCCGCTCCGGATGATACTTCGTACCTTGAATACCCCGGCTACGTATTGGAGCACAACTTCCTGCGTAAAGCCGGGGTGTGTGTATTCGTCCGGGCTGATGTCTGTTGTCGCCGTCTACGAAGCCTCGAACAACGGGACCTGTCCCTCTTGTGGCTGCGCGTAGATCACGGGGGTTGTACCCGAGTCTACGCGTGCCTGTACAGGTCCCACAGCAGTGATGCAGGTTCAACTCTGATAGAGCATGTGCAAGAGGGGACTAACCGCATGCTTGAGCAGTACCCATCTGCGGAGGTGGTGGTTCTTGGAGACTTTAACGCTCACCACCAAGAGTGGTTGGGGTCCAGAACCACTGACCTCCCGGGTCGGGCTGCCTACGATTTCGCCTTGGCCTACGGCCTCTCCCAGCTGGTGACACAGCCCACCCGTGTCCCAGATATTGAGGGGCACGAGCCTTCTCTGTTGGACCTTCTGCTGACCACCGATCCAGCCGGATACAGTGTGGTGGTCGACGCTCCACTTGGATCGTCTGATCACTGCCTTATCCGTGCTGCCACACCACTCTCTCGTCCTAGTCGTCGAACGACGACCAGGTATCGAAGAGTTTGGCAGTATTTGTCAGCAGATTGGGATGGATTGCGTGAGTTTTACGCATCCTACCCATGGGGGCGGTTCTGCTTTTCCTCTGCTGATCCTGACGTCTGTGCGGACCGACTTAAAGACGTGGTGCTCCAGGGGATGGAATTGTTTATCCCCTCCTCTGAAGTGCCCGTTGGGGGTCGCAGCAGACCCTGGTATAACAATGCCAGCAGGGATGCTGCACACCTCAAGCGGTCCGCATACGTTGCATGGGATGATGCTAGGAGACGTCGGGATCCTAACATCTCAGAGGAAAGGCGGAAATATAACGCCGCTTCCAGGTCCTACAAGAAGGTTATTGCCAGGGCGAAATCGGAGCACGTTGCTAGAATTGGCGAGCGACTGAAGAGCTATCCCTCTGGGAGCCGTGCTTTTTGGTCGCTCGCCAAAGCTGCAGAAGGTAACTTTTGCAGGTCTAGTCTCCCACCACTACGCAAGTCCGATGACAGTCTGGCCCATAGTGCGAAAGAGAAGGCTGACCTTCTGGTCAAACTCTTCGCCTCGAACTCGACTGTGGACGACGGGGGTGCCACACCACCGAACATCCTCCGGTGTGATAGTTCCCTGCCGGAGATCTGCTTTACACAGTGTGCAGTCAGGCGGGAACTCCGACTCCTGGACGTCCATAAGTCGAGCGGGCCAGACGGCATCCCTGCAGTGGTTCTGAAAACGTGCGCCCCTGAGCTGACACCTGCGCTAACGCGTTTGTATCGCCTCTCTTATTGCACTAACAGGGTCCCGTCTTCATGGAAGACTGCCCACGTCCACCCTATCCCCAAGAAGGGTGACCGGTCGGACCCATCGAGCTATAGGCCTATCGCGATAACTTCCTTGCTTTCCAAGGTGATGGAGCGAATAATTAATATACAACTCCTGAAGTATCTGGAGGATCGCCAGCTGATCAGTGACCGACAGTACGGTTTCCGTCACGGTCGCTCAGCTGGCGATCTTCTTGTATACCTTACTCACAGGTGGGCTGAAGCCTTGGAGAGCAAGGGCGAGGCTCTTGCTGTGAGCCTTGATATCGCGAAGGCCTTCGACAGGGTCTGGCATAGGGCACTTCTGTCGAAGCTACCATCTTACGGAATCCCCGAGGGTCTCTGCAAGTGGATCGCTAGCTTTTTGGATGGGCGGAGCATCACGGTCGTTGTAGACGGTGACTGTTCTGATACCATGACCATTAACGCTGGCGTTCCACAAGCACGGGGGATGCGCGATATATCGGCCATCAGAGTCTCTCTCGGAGCGTGGTGCAAGAGAGACGATCAAAACTTGTGTCTGAAGTGGAGAACTCTCTGGGGCGAGTCTCCAAATGGGGTGAATTGA
Protein
MKVRKRKRVLSAIPHSTFNVDFSNVRGLHSNLDAVHHHLETAQPALLFLTETQISAPDDTSYLEYPGYVLEHNFLRKAGVCVFVRADVCCRRLRSLEQRDLSLLWLRVDHGGCTRVYACLYRSHSSDAGSTLIEHVQEGTNRMLEQYPSAEVVVLGDFNAHHQEWLGSRTTDLPGRAAYDFALAYGLSQLVTQPTRVPDIEGHEPSLLDLLLTTDPAGYSVVVDAPLGSSDHCLIRAATPLSRPSRRTTTRYRRVWQYLSADWDGLREFYASYPWGRFCFSSADPDVCADRLKDVVLQGMELFIPSSEVPVGGRSRPWYNNASRDAAHLKRSAYVAWDDARRRRDPNISEERRKYNAASRSYKKVIARAKSEHVARIGERLKSYPSGSRAFWSLAKAAEGNFCRSSLPPLRKSDDSLAHSAKEKADLLVKLFASNSTVDDGGATPPNILRCDSSLPEICFTQCAVRRELRLLDVHKSSGPDGIPAVVLKTCAPELTPALTRLYRLSYCTNRVPSSWKTAHVHPIPKKGDRSDPSSYRPIAITSLLSKVMERIINIQLLKYLEDRQLISDRQYGFRHGRSAGDLLVYLTHRWAEALESKGEALAVSLDIAKAFDRVWHRALLSKLPSYGIPEGLCKWIASFLDGRSITVVVDGDCSDTMTINAGVPQARGMRDISAIRVSLGAWCKRDDQNLCLKWRTLWGESPNGVN

Summary

Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF00002   7tm_2
PF04939   RRS1
PF01585   G-patch
PF02460   Patched
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR000832   GPCR_2_secretin-like       
IPR017981   GPCR_2-like       
IPR007023   Ribosom_reg       
IPR012677   Nucleotide-bd_a/b_plait_sf       
IPR000504   RRM_dom       
IPR034653   SPF45_RRM       
IPR003954   RRM_dom_euk       
IPR000467   G_patch_dom       
IPR040052   RBM17       
IPR035979   RBD_domain_sf       
IPR030223   Dispatched       
IPR003392   Ptc/Disp       
IPR000731   SSD       
SUPFAM
SSF56219   SSF56219        + More
SSF54928   SSF54928       
Gene 3D
PDB
6AR3     E-value=0.0151056,     Score=92

Ontologies

Topology

Length:
707
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00362000000000001
Exp number, first 60 AAs:
0.00061
Total prob of N-in:
0.00210
outside
1  -  707
 
 

Population Genetic Test Statistics

Pi
1.683139
Theta
1.140206
Tajima's D
0
CLR
2.593848
CSRT
0.425578721063947
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号