SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO11240
Annotation
PREDICTED:_uncharacterized_protein_LOC106713896?_partial_[Papilio_machaon]
Location in the cell
Mitochondrial   Reliability : 1.522 PlasmaMembrane   Reliability : 1.124
 

Sequence

CDS
ATGTATCGGGATGTCGTTGCAGTCGATAAGGGGCTAACTCCGCTATCCTTAGCTAACGGGAATTGGAAGAGGCTGAAGGTAGAGGGTATTTCAGATCGCATAACCGTATGGAGGAGCAAGGAGTTACACGGTAGGTTCTACCGGGCTCTCACAGGGCCTGATGTAGACCAATTAGCTTCCGTGGCCTGGTTACGATTCAGTAACCTCTTTGGGGAAACTGAAGGTTTTATCTTTGCAATTATGGACGAAGTTATCATGACGAACAACTACCGGAAATATATACTAAAGGATGGGACGGTCGACATTTGTCGGGCATGCCACCGTCCGGGAGAGTCTATTAGACATATTGTTTCTGGCTGTTCTCGGTTTGCTAACGGCGAGTACTTGCATAGACATAACCAAGTGGCTAGGATTATCCATCAACAACTTGCTCTGAAATATGGTTTTCTTGATTCTGCTGTACCTTATTACCAATACCAACCTCAACCAGTTCTTGATAATGGTCATGTTACGCTCTACTGGGACCGATCTATTATCACGGATAGGTATATTGTTGCCAATAAACCTGATATTGTGATAATAGATCGATCTGCGCGTCGAGCAGTGTTGGTTGATGTCACCATTCCTCATGACGAGAACCTCGTGAAGGCAGAAAAGGACAAATTAATAAAATATTTAGACCTGGCCCACGAGACTACCGCCATGTGGCATGTTGATTCAACCATCATTGTTCCAATAGTTGTATCGGTACACGGCTTGATAGCGAAAAGTTTCGATCAACATCTTAAGAAACTTTCGTTATCCAGCTGGGTTAAGGGCCTAATACAGAAAGCAGTTATCCTCGATACTGCACGCATTGTGAGGAGGTTTCTCACTCTGGAGTCCTAA
Protein
MYRDVVAVDKGLTPLSLANGNWKRLKVEGISDRITVWRSKELHGRFYRALTGPDVDQLASVAWLRFSNLFGETEGFIFAIMDEVIMTNNYRKYILKDGTVDICRACHRPGESIRHIVSGCSRFANGEYLHRHNQVARIIHQQLALKYGFLDSAVPYYQYQPQPVLDNGHVTLYWDRSIITDRYIVANKPDIVIIDRSARRAVLVDVTIPHDENLVKAEKDKLIKYLDLAHETTAMWHVDSTIIVPIVVSVHGLIAKSFDQHLKKLSLSSWVKGLIQKAVILDTARIVRRFLTLES

Summary

EMBL
RSAL01001347    RVE40825.1    NWSH01001199    PCG72152.1    ODYU01008727    SOQ52576.1    + More
RSAL01000200    RVE44451.1    ODYU01004516    SOQ44481.1    KZ150607    PZC70460.1    UFQT01000728    SSX26770.1    GEZM01035222    JAV83335.1    ODYU01011284    SOQ56923.1    GEZM01035223    JAV83334.1    GEZM01022180    JAV88769.1    GAMC01018221    JAB88334.1    AFYH01046062    AFYH01147180    GG695107    EFA13287.1    AFYH01158743    AFYH01207636    ODYU01003901    SOQ43240.1    AB097127    BAC82595.1    AFYH01017561    GG695857    EFA13462.1    AFYH01227415    GAMC01016897    JAB89658.1    AFYH01259886    AFYH01052121    ODYU01003427    SOQ42175.1    NCKU01013699    RWR99758.1    NEVH01007832    PNF34997.1    NEVH01024955    PNF16260.1    DS235004    EEB10225.1    NEVH01026385    PNF14463.1    NEVH01003752    PNF40040.1    DS235859    EEB19129.1    DS235861    EEB19180.1    DS235366    EEB15312.1    DS235750    EEB16295.1    EEB15300.1    AFYH01167468    AFYH01026690    NEVH01021925    PNF19338.1    GG695465    EFA13373.1    AFYH01264165    AFYH01092381    AFYH01092382    AAWZ02024166    AFYH01248595    AFYH01268965    AFYH01132769    AAWZ02035408    AFYH01140129    AAWZ02036698    AFYH01154158    AYCK01026151    AFYH01155094    AFYH01154199   
Pfam
PF00078   RVT_1
Interpro
IPR000477   RT_dom        + More
IPR001611   Leu-rich_rpt       

Ontologies

Topology

Length:
295
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
3.73578
Exp number, first 60 AAs:
0.00358
Total prob of N-in:
0.12976
outside
1  -  295
 
 

Population Genetic Test Statistics

Pi
152.423496
Theta
80.010538
Tajima's D
2.699988
CLR
21.372855
CSRT
0.96085195740213
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号