SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO11147  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA008579
Annotation
PREDICTED:_fatty_acid_synthase-like_[Bombyx_mori]
Location in the cell
PlasmaMembrane   Reliability : 2.464
 

Sequence

CDS
ATGGACTTCAGTGGCTATAATTCAAAAGGCGAGAAAATAATGGGTTTGGTACGCGAAGGGTCGTTATCTAGCTCAGTGGAAGCTGATCCAGATCTAACGTGGTCAGTACCTGAACACTGGACGCTTGAAGACGCAGCCACCGTTCCCCTAGCGTATCTTCATGCCTTCTATTGCTTGGCACTAAGGAGCAATGTTTCTAGTGGAAAAACAGTATTCATCACGGGAGGCGCTGGGGCTCTGGGACAAGCAGTCATCTCCATATGCCTGGCTATGAACTGTTCTATTTACACAACCGTAAAAGATATTTATAAGAAGAACTTTTTATTGCAGCTATTCCCTGAACTTCCAGAAAGTCACATCGGATTTTCGCACCTTGAAGCTTTATATAACATGCCTGTATTTAATTCTGAGAATAAACGTTGCGATATAATTATAAATTTAGACAGCGGTCATCTACGAGAGGCTTTGATGAAATGTGTCAGAGCCAGTGGCATATTTTTGGACATCAGCAAATCAGACATGAATAAAAACAAAGATTTCTACATGGGGTTTATCCGAGGCGATAGATCGTATAAGGCTGTTGATTTTTCTAATATTTTCAGGATTGAATTCGCTGAAGACAAGAAGGTATTTTTATGA
Protein
MDFSGYNSKGEKIMGLVREGSLSSSVEADPDLTWSVPEHWTLEDAATVPLAYLHAFYCLALRSNVSSGKTVFITGGAGALGQAVISICLAMNCSIYTTVKDIYKKNFLLQLFPELPESHIGFSHLEALYNMPVFNSENKRCDIIINLDSGHLREALMKCVRASGIFLDISKSDMNKNKDFYMGFIRGDRSYKAVDFSNIFRIEFAEDKKVFL

Summary

EMBL
BABH01033622    BABH01033623    BABH01033624    NWSH01005646    PCG64083.1    BABH01033637    + More
U67866    AAB53257.1    NWSH01005017    PCG64490.1    ODYU01001294    SOQ37311.1    RSAL01000068    RVE49259.1    ODYU01012325    SOQ58579.1    KQ461073    KPJ09498.1    NWSH01000591    PCG75472.1    NWSH01000156    PCG78966.1    JTDY01000529    KOB76791.1    PCG75471.1    PCG78965.1    PCG78967.1    KQ459602    KPI93194.1    KQ461178    KPJ07769.1    ODYU01001484    SOQ37744.1    ODYU01003708    SOQ42815.1    AGBW02011888    OWR45966.1    JTDY01006902    KOB65606.1    NEVH01025646    PNF15231.1    RSAL01000013    RVE53445.1    JTDY01000426    KOB77236.1    KQ459053    KPJ04123.1    UFQT01000602    SSX25625.1    GALX01004174    JAB64292.1    PNF15229.1    KX467777    AOA60273.1    GEZM01096807    JAV54566.1    KK852680    KDR18643.1    APGK01049539    APGK01049540    KB741156    ENN73526.1    KB632169    ERL89446.1    LSMT01000411    PFX18424.1    NEVH01025661    PNF15062.1    MF817713    AXE71619.1    MF062033    ATU31751.1    KK857421    PTY27158.1    NNAY01001061    OXU25291.1    KM042200    AJW76499.1    LBMM01005284    KMQ91654.1    KK854036    PTY09977.1    GFTR01008959    JAW07467.1    NEVH01016965    PNF24835.1    RCHS01002288    RMX48359.1    JTDY01000102    KOB78858.1    PNF24833.1    PNF24834.1    GFAH01000232    JAV48157.1    PNF15063.1    LBMM01015399    KMQ84825.1    KY797274    ATL76713.1    GBBM01000412    JAC35006.1    KX147671    ARI45075.1    GEZM01035401    JAV83262.1    CAAE01012412    CAF94659.1    GECU01000102    JAT07605.1    GBBM01000409    JAC35009.1    ACPB03012542    QCYY01002654    ROT68596.1    HM595630    ADM88556.1    KQ976413    KYM90403.1    JH432116    GFAC01003246    JAT95942.1    KQ971319    EFA11365.1    KQ770827    OAD52584.1    KQ971344    EFA05203.2    GEIB01000832    JAR87184.1    GEBQ01001399    JAT38578.1    KQ435796    KOX73549.1    GECZ01002433    JAS67336.1    PCG78963.1    KK107077    QOIP01000010    EZA60541.1    RLU17791.1    KQ980612    KYN15123.1    QOIP01000002    RLU26096.1    ADTU01010333    ADTU01010334    KQ982519    KYQ55543.1    GECZ01005755    JAS64014.1    GL888565    EGI59473.1    KQ977642    KYN01094.1    GL442783    EFN63051.1    KQ981954    KYN32228.1    ACPB03012543    ACPB03012544    LBMM01001339    KMQ96487.1    JXUM01091581    JXUM01091582    GACK01000522    JAA64512.1    KQ459252    KPJ02209.1    NNAY01001760    OXU23005.1    GL771642    EFZ09693.1    KQ461185    KPJ07407.1   
Pfam
PF07690   MFS_1        + More
PF02801   Ketoacyl-synt_C
PF00698   Acyl_transf_1
PF00109   ketoacyl-synt
PF08659   KR
PF00975   Thioesterase
PF16197   KAsynt_C_assoc
PF14765   PS-DH
PF00107   ADH_zinc_N
PF00550   PP-binding
Interpro
IPR020841   PKS_Beta-ketoAc_synthase_dom        + More
IPR020846   MFS_dom       
IPR001227   Ac_transferase_dom_sf       
IPR036259   MFS_trans_sf       
IPR020843   PKS_ER       
IPR014030   Ketoacyl_synth_N       
IPR016039   Thiolase-like       
IPR020801   PKS_acyl_transferase       
IPR011701   MFS       
IPR042104   PKS_dehydratase_sf       
IPR011032   GroES-like_sf       
IPR036291   NAD(P)-bd_dom_sf       
IPR014043   Acyl_transferase       
IPR016036   Malonyl_transacylase_ACP-bd       
IPR016035   Acyl_Trfase/lysoPLipase       
IPR014031   Ketoacyl_synth_C       
IPR013968   PKS_KR       
IPR020807   PKS_dehydratase       
IPR029058   AB_hydrolase       
IPR023102   Fatty_acid_synthase_dom_2       
IPR032821   KAsynt_C_assoc       
IPR001031   Thioesterase       
IPR018201   Ketoacyl_synth_AS       
IPR013149   ADH_C       
IPR020806   PKS_PP-bd       
IPR009081   PP-bd_ACP       
IPR036736   ACP-like_sf       
IPR006162   Ppantetheine_attach_site       
IPR029063   SAM-dependent_MTases       
IPR020802   PKS_thioesterase       
SUPFAM
SSF103473   SSF103473        + More
SSF55048   SSF55048       
SSF50129   SSF50129       
SSF53901   SSF53901       
SSF51735   SSF51735       
SSF52151   SSF52151       
SSF53474   SSF53474       
SSF47336   SSF47336       
SSF53335   SSF53335       
PDB
4W9N     E-value=2.92798e-33,     Score=351

Ontologies

Topology

Length:
212
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
17.68483
Exp number, first 60 AAs:
0.59121
Total prob of N-in:
0.04799
outside
1  -  212
 
 

Population Genetic Test Statistics

Pi
19.432033
Theta
24.04162
Tajima's D
-0.544998
CLR
3.193215
CSRT
0.230238488075596
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号