SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO11146
Annotation
PREDICTED:_fatty_acid_synthase-like_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 2.088
 

Sequence

CDS
ATGGATTACAGATACCTTTCTGTTATATTCAAAGACATACATTTTCATAGGGAAGTTGAAATTAAACGCGACATTCCGCTAAGACTATCTATAAGTATAACTAAAGGAAACAATAAGTTCGAGGTTATCCATGAAAATATGATAGTGGTCAGTGGAATCGTTCGTGGCGTGAAAGTTTTCAAGTTTCACCATGACATAGACGAAACCGAATTTCATGAAGATGAAATTTTACTTAACAACGAAGATATTTACGAAATTCTAAAGTTGCGTGGACACTATTACACAGGTGAACATAAATCTATAGCATCAACGAACTTAGAACGGAATAAGGCGATAGTTCGGTGGAACAATAATTGGGCCTTATATCTAGATTCACTCATACAACTGAACATATTGGCTAATGAGCACGAGGGCTTGTCAATCCCGAAATTTATTGGAAAAATAAGGATCAGTGTGTTCGAACATGAAAAGGCTAAACAAAAAGTTGATAATTCGATTGATTGTCATGTAGCCAATATCATTGATACATATGGAGTAACAAGGTGCGCAGGAGTTGAGATAGACCGCTTAATTTTCACCGAGAAAGCAGTTATAGACAAAGAGGCAGACGGCCTACAAATATTAACGTTCTGTCCACAATATCCAACCGAGGAAGTTAGTGTAAGTACCTAA
Protein
MDYRYLSVIFKDIHFHREVEIKRDIPLRLSISITKGNNKFEVIHENMIVVSGIVRGVKVFKFHHDIDETEFHEDEILLNNEDIYEILKLRGHYYTGEHKSIASTNLERNKAIVRWNNNWALYLDSLIQLNILANEHEGLSIPKFIGKIRISVFEHEKAKQKVDNSIDCHVANIIDTYGVTRCAGVEIDRLIFTEKAVIDKEADGLQILTFCPQYPTEEVSVST

Summary

Similarity
Belongs to the thiolase-like superfamily. Beta-ketoacyl-ACP synthases family.
EMBL
BABH01033613    BABH01033614    BABH01033615    BABH01033616    BABH01033617    BABH01033618    + More
BABH01033622    BABH01033623    BABH01033624    NWSH01005017    PCG64490.1    ODYU01001294    SOQ37311.1    JTDY01002046    KOB72242.1    BABH01033637    U67866    AAB53257.1    NWSH01000591    PCG75472.1    ODYU01012325    SOQ58579.1    KQ459053    KPJ04123.1    KPJ04122.1    RSAL01000068    RVE49259.1    KQ461073    KPJ09498.1    PCG75471.1    KQ460598    KPJ13817.1    NWSH01000156    PCG78967.1    KQ459602    KPI93194.1    AGBW02011888    OWR45966.1    KQ461178    KPJ07769.1    JTDY01004048    KOB68668.1    GEYN01000116    JAV02013.1    JTDY01000529    KOB76786.1    PCG78966.1    JTDY01003591    KOB69292.1    JTDY01000426    KOB77236.1    ODYU01003708    SOQ42815.1    RSAL01000013    RVE53445.1    ADTU01005072    ADTU01005073    ADTU01005074    ADTU01005075    KQ981856    KYN34617.1    PCG78963.1    ODYU01001484    SOQ37744.1    JTDY01002311    KOB71689.1    UFQT01000602    SSX25625.1    RVE53442.1    GL445739    EFN89136.1    KQ976440    KYM86527.1    GECU01021338    JAS86368.1    GECU01006695    JAT01012.1    KK107139    EZA57700.1    QOIP01000003    RLU24885.1    PCG78965.1    KQ982480    KYQ55999.1    NEVH01022635    PNF18737.1    KQ978607    KYN29892.1    NNAY01001760    OXU23004.1    GECZ01010430    JAS59339.1    PNF18740.1    GEBQ01031053    JAT08924.1    LBMM01000911    KMQ97230.1    GL888175    EGI66082.1    OXU23005.1    PNF18741.1    BABH01022926    BABH01022927    BABH01022928    BABH01022903    DS231997    EDS30986.1    GEZM01038915    JAV81486.1    APGK01052936    APGK01052937    KB741216    ENN72556.1    KQ971344    EFA05249.2    KQ761246    OAD57941.1    GFDL01004709    JAV30336.1    KZ288370    PBC26760.1    BABH01003987    BABH01003988    CVRI01000051    CRK99510.1    U67867    AAB53258.1    ATLV01019467    ATLV01019468    KE525272    KFB44203.1    GL434526    EFN74822.1    KQ976697    KYM77568.1    KQ980791    KYN13150.1    EFA05203.2    KQ981707    KYN37411.1    NEVH01025646    PNF15229.1    GL438820    EFN68400.1    KQ434960    KZC12654.1    KQ978053    KYM97760.1    KQ435885    KOX69550.1    NEVH01025661    PNF15064.1    GEZM01017272    JAV90811.1    AXCM01003979    AGBW02007651    OWR55047.1    CH964272    EDW84866.1    GL438338    EFN69129.1    RSAL01000071    RVE49124.1    AAAB01008964    KQ414663    KOC65238.1    CH916368    EDW02934.1    JTDY01005601    KOB66846.1    APGK01049539    APGK01049540    KB741156    ENN73526.1    KB632169    ERL89446.1    ODYU01006431    SOQ48269.1    RLU25184.1    KZ150116    PZC73265.1    GEZM01041011    JAV80651.1   
Pfam
PF00109   ketoacyl-synt        + More
PF16197   KAsynt_C_assoc
PF00698   Acyl_transf_1
PF02801   Ketoacyl-synt_C
PF07690   MFS_1
PF00975   Thioesterase
PF14765   PS-DH
PF00107   ADH_zinc_N
PF08659   KR
PF00550   PP-binding
Interpro
IPR011032   GroES-like_sf        + More
IPR042104   PKS_dehydratase_sf       
IPR032821   KAsynt_C_assoc       
IPR014043   Acyl_transferase       
IPR036291   NAD(P)-bd_dom_sf       
IPR016036   Malonyl_transacylase_ACP-bd       
IPR016035   Acyl_Trfase/lysoPLipase       
IPR014031   Ketoacyl_synth_C       
IPR020841   PKS_Beta-ketoAc_synthase_dom       
IPR020843   PKS_ER       
IPR014030   Ketoacyl_synth_N       
IPR016039   Thiolase-like       
IPR020801   PKS_acyl_transferase       
IPR020846   MFS_dom       
IPR001227   Ac_transferase_dom_sf       
IPR036259   MFS_trans_sf       
IPR011701   MFS       
IPR001031   Thioesterase       
IPR023102   Fatty_acid_synthase_dom_2       
IPR029058   AB_hydrolase       
IPR020807   PKS_dehydratase       
IPR018201   Ketoacyl_synth_AS       
IPR013149   ADH_C       
IPR013968   PKS_KR       
IPR009081   PP-bd_ACP       
IPR036736   ACP-like_sf       
IPR020806   PKS_PP-bd       
IPR006162   Ppantetheine_attach_site       
SUPFAM
SSF55048   SSF55048        + More
SSF50129   SSF50129       
SSF51735   SSF51735       
SSF52151   SSF52151       
SSF53901   SSF53901       
SSF103473   SSF103473       
SSF53474   SSF53474       
SSF47336   SSF47336       
PDB
2VZ9     E-value=1.96751e-12,     Score=172

Ontologies

Topology

Length:
223
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.006
Exp number, first 60 AAs:
0.00249
Total prob of N-in:
0.05131
outside
1  -  223
 
 

Population Genetic Test Statistics

Pi
22.743454
Theta
23.410155
Tajima's D
0.101564
CLR
2.946601
CSRT
0.398830058497075
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号