SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO11144  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA008602
Annotation
p260_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.577
 

Sequence

CDS
ATGCGGGAACCCAAACTTTTAACGTCAAATATATTTAACAAAGGTCCTGATTACTTTACTGACCTACAACGCTACAAAAGCAGCATACCTCATTTAGTGCTAGCATCTGGTAGACAGAATAACTGCGTAGAGAAGATTTTCGAATCACTAAAGAATAGACCCGTTGATGCCGAGCAAATTGCACTGATACACGACATCCATGATTACGAGATAGCTGGACATATGTGCAGAGGATACATAATACTTGAAAACAATGAGAACAATGAAACCGTCTGCCTCACTGAAAGCATAGAGTACTGCCCAGGTATTACTCGTCCGGTGTGGTTCGTCTACAGTGGAATGGGAAGCCAATGGGCTGGTATGGGAGCTGAATTAATGAGGATTCCTGTATTTGCTGCTGCTATTGAAAAATGCCACAAAGTTCTCGCGCCCAAGGGTATTGATATCGTCCGCATCCTGTGTGAACCAGATAAAACTATCTTTGACAACATTCTCCATTCATTTGTTGGAATTGCTGCTGTCCAGATCGGACTTACTGATGTCTTGAGAGAAATAGGAATAGTTCCTGATCACATCATTGGTAAGTGA
Protein
MREPKLLTSNIFNKGPDYFTDLQRYKSSIPHLVLASGRQNNCVEKIFESLKNRPVDAEQIALIHDIHDYEIAGHMCRGYIILENNENNETVCLTESIEYCPGITRPVWFVYSGMGSQWAGMGAELMRIPVFAAAIEKCHKVLAPKGIDIVRILCEPDKTIFDNILHSFVGIAAVQIGLTDVLREIGIVPDHIIGK

Summary

EMBL
BABH01033637    U67866    AAB53257.1    JTDY01000529    KOB76787.1    ODYU01007677    + More
SOQ50673.1    KOB76786.1    NWSH01000591    PCG75471.1    AGBW02011888    OWR45966.1    RSAL01000068    RVE49259.1    NWSH01005017    PCG64490.1    ODYU01012610    SOQ59025.1    RSAL01000013    RVE53445.1    RVE53442.1    NWSH01000156    PCG78965.1    KQ459602    KPI93194.1    JTDY01003335    KOB69710.1    JTDY01003263    KOB69848.1    JTDY01002046    KOB72242.1    PCG78967.1    BABH01022903    ODYU01009787    SOQ54442.1    JTDY01003650    KOB69211.1    BABH01022894    BABH01022895    BABH01022896    BABH01022897    KQ461178    KPJ07769.1    PCG78966.1    PCG75472.1    BABH01003986    KZ150116    PZC73268.1    JTDY01003390    KOB69631.1    ODYU01000872    SOQ36288.1    RSAL01000071    RVE49124.1    NWSH01003873    PCG65731.1    PCG65733.1    U67867    AAB53258.1    PCG78963.1    KQ459582    KPI99075.1    ODYU01000212    SOQ34605.1    ODYU01011246    SOQ56864.1    KQ460651    KPJ13003.1    JTDY01000102    KOB78858.1    AGBW02007651    OWR55047.1    GEBQ01017893    JAT22084.1    GECZ01010430    JAS59339.1    GECU01006695    JAT01012.1    GECU01021338    JAS86368.1    ODYU01002244    SOQ39469.1    JTDY01011828    KOB52382.1    GEDC01024813    JAS12485.1    KQ982480    KYQ55999.1    GL765434    EFZ16301.1    KQ981856    KYN34617.1    KQ978607    KYN29892.1    KQ459053    KPJ04123.1    KPJ04122.1    KPJ04124.1    GBYB01008708    JAG78475.1    ADTU01005072    ADTU01005073    ADTU01005074    ADTU01005075    GL888175    EGI66082.1    KQ461073    KPJ09498.1    NEVH01022635    PNF18741.1    KQ976440    KYM86527.1    KQ977574    KYN01849.1    LBMM01000911    KMQ97230.1    KK852680    KDR18643.1    NNAY01001038    OXU25389.1    KQ971314    EEZ97866.2    GL438820    EFN68400.1    NNAY01001760    OXU23004.1    KB631760    ERL85885.1    KK107139    EZA57700.1    NEVH01025646    PNF15229.1    CVRI01000051    CRK99510.1    UFQS01001117    UFQT01001117    SSX09070.1    SSX28981.1    GEZM01013544    JAV92493.1    CCAG010017947    CCAG010001609    KK852983    KDR12868.1    JTDY01000426    KOB77236.1    KQ435885    KOX69550.1    GECU01009677    JAS98029.1    KQ434960    KZC12654.1    GL445739    EFN89136.1    CH922465    EDV99508.1    CH940650    EDW67835.2    JRES01001625    KNC21349.1    CH964272    EDW84866.1    CH916858    EDV91606.1   
Pfam
PF00975   Thioesterase        + More
PF00698   Acyl_transf_1
PF16197   KAsynt_C_assoc
PF00109   ketoacyl-synt
PF14765   PS-DH
PF02801   Ketoacyl-synt_C
PF00107   ADH_zinc_N
PF08659   KR
PF00550   PP-binding
Interpro
IPR016039   Thiolase-like        + More
IPR020843   PKS_ER       
IPR014030   Ketoacyl_synth_N       
IPR020801   PKS_acyl_transferase       
IPR020841   PKS_Beta-ketoAc_synthase_dom       
IPR020807   PKS_dehydratase       
IPR001227   Ac_transferase_dom_sf       
IPR029058   AB_hydrolase       
IPR016036   Malonyl_transacylase_ACP-bd       
IPR014031   Ketoacyl_synth_C       
IPR023102   Fatty_acid_synthase_dom_2       
IPR016035   Acyl_Trfase/lysoPLipase       
IPR032821   KAsynt_C_assoc       
IPR042104   PKS_dehydratase_sf       
IPR011032   GroES-like_sf       
IPR001031   Thioesterase       
IPR014043   Acyl_transferase       
IPR036291   NAD(P)-bd_dom_sf       
IPR018201   Ketoacyl_synth_AS       
IPR013149   ADH_C       
IPR013968   PKS_KR       
IPR036736   ACP-like_sf       
IPR020806   PKS_PP-bd       
IPR009081   PP-bd_ACP       
IPR006162   Ppantetheine_attach_site       
SUPFAM
SSF53474   SSF53474        + More
SSF53901   SSF53901       
SSF51735   SSF51735       
SSF52151   SSF52151       
SSF55048   SSF55048       
SSF50129   SSF50129       
SSF47336   SSF47336       
PDB
3HHD     E-value=1.1485e-26,     Score=294

Ontologies

Topology

Length:
195
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.20428
Exp number, first 60 AAs:
0
Total prob of N-in:
0.08805
outside
1  -  195
 
 

Population Genetic Test Statistics

Pi
13.8089
Theta
26.863814
Tajima's D
-1.591923
CLR
0.214824
CSRT
0.0454977251137443
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号