SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO11143  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA008602
Annotation
p260_[Bombyx_mori]
Location in the cell
Extracellular   Reliability : 1.33 Mitochondrial   Reliability : 1.135
 

Sequence

CDS
ATGATTTTATCAGCGTACAGCCGAGGTCTGGTTTCTGTGCAAACACCATTCATTCGTGGGTCCATGGCCGCCGTTGGACTCGGATATAAGAATATCCTACCACTCTGTCCGCCTGAAATCGAAGTGGCTTGCCACAATAGTTCGGACTCTTCAACAATATCAGGACCCGCTGAACCAATGAAGAAGTTCATCTCTGAGCTCACCAGTAAAGGGATATTTGCCAAAGAAGTACCCTGCTCTAACATCTCGTTTCATTCGAGATACATAGCTGATGGCGGTCCTGGCCTTTTAAAATACTTGAGTGATGTCATCAAAGACCCGAAGCCACGGAGTGAAAAGTGGGTATCTACATCTGTACCACAAGAAAACTGGGATGATCCTAAAGCTAAGTTCTCGTCAGCCGAGTATCACACTAATAATTTATTGAACCCAGTACTATTCGAAGAAACTTCAAAGCTAATACCATCAGACTCATTGGTCATTGAGATTGCACCTCACGGATTATTACAAGCGATCCTTAAGAGGTCTATGCCGGAATGTCAACATCTTCCCCTGACCAGACGAGGACATGCTGATCCCGTAAAATTTTTACTGGAAGGAATTGGAAAGTAA
Protein
MILSAYSRGLVSVQTPFIRGSMAAVGLGYKNILPLCPPEIEVACHNSSDSSTISGPAEPMKKFISELTSKGIFAKEVPCSNISFHSRYIADGGPGLLKYLSDVIKDPKPRSEKWVSTSVPQENWDDPKAKFSSAEYHTNNLLNPVLFEETSKLIPSDSLVIEIAPHGLLQAILKRSMPECQHLPLTRRGHADPVKFLLEGIGK

Summary

EMBL
BABH01033637    U67866    AAB53257.1    ODYU01007677    SOQ50673.1    JTDY01000529    + More
KOB76786.1    JTDY01011888    KOB52367.1    RSAL01000068    RVE49259.1    NWSH01000156    PCG78966.1    KQ459602    KPI93194.1    JTDY01003263    KOB69848.1    ODYU01000872    SOQ36288.1    ODYU01001484    SOQ37744.1    KQ461178    KPJ07769.1    AGBW02011888    OWR45966.1    ODYU01003708    SOQ42815.1    JTDY01000102    KOB78858.1    RSAL01000013    RVE53445.1    PCG78967.1    NWSH01000591    PCG75471.1    EZ407214    ACX53772.1    BABH01022894    BABH01022895    BABH01022896    BABH01022897    BABH01022903    JTDY01009790    KOB62677.1    RVE53442.1    KQ459582    KPI99075.1    NWSH01005017    PCG64490.1    KQ460651    KPJ13003.1    BABH01022926    PCG75472.1    BABH01003986    JTDY01005583    KOB66860.1    JTDY01005601    KOB66845.1    NWSH01003873    PCG65731.1    PCG65733.1    KOB76787.1    AGBW02007651    OWR55047.1    PCG78963.1    ODYU01006431    SOQ48269.1    GL765434    EFZ16301.1    NNAY01001760    OXU23004.1    PCG78965.1    BABH01033613    BABH01033614    BABH01033615    BABH01033616    BABH01033617    BABH01033618    GL888175    EGI66082.1    KQ976440    KYM86527.1    KZ150116    PZC73267.1    KQ978607    KYN29892.1    KQ977574    KYN01849.1    U67867    AAB53258.1    KQ761246    OAD57941.1    KQ461073    KPJ09498.1    ADTU01005072    ADTU01005073    ADTU01005074    ADTU01005075    LBMM01000911    KMQ97230.1    KQ982480    KYQ55999.1    KQ414663    KOC65238.1    KQ435885    KOX69550.1    KK107139    EZA57700.1    AJVK01012004    KQ434960    KZC12654.1    KQ981856    KYN34617.1    GL445739    EFN89136.1    OXU23005.1    JTDY01003390    KOB69632.1    BABH01033622    BABH01033623    BABH01033624    KQ459053    KPJ04123.1    KZ288370    PBC26760.1    KPJ04124.1    KPJ04122.1    JXJN01031121    GL438820    EFN68400.1    RSAL01000071    RVE49124.1    CCAG010013878    AXCM01001692    AXCN02000191    AJVK01011044    AAAB01008987    EAA01044.4    APCN01002072    GAKP01015045    JAC43907.1    KA644718    AFP59347.1    GAKP01015046    JAC43906.1    ATLV01015783    ATLV01015784    KE525036    KFB40722.1    ADMH02002134    ETN58382.1    AAZX01001298   
Pfam
PF00975   Thioesterase        + More
PF00698   Acyl_transf_1
PF16197   KAsynt_C_assoc
PF00109   ketoacyl-synt
PF14765   PS-DH
PF02801   Ketoacyl-synt_C
PF08659   KR
PF00107   ADH_zinc_N
PF00550   PP-binding
PF07690   MFS_1
Interpro
IPR016039   Thiolase-like        + More
IPR020843   PKS_ER       
IPR014030   Ketoacyl_synth_N       
IPR020801   PKS_acyl_transferase       
IPR020841   PKS_Beta-ketoAc_synthase_dom       
IPR020807   PKS_dehydratase       
IPR001227   Ac_transferase_dom_sf       
IPR029058   AB_hydrolase       
IPR016036   Malonyl_transacylase_ACP-bd       
IPR014031   Ketoacyl_synth_C       
IPR023102   Fatty_acid_synthase_dom_2       
IPR016035   Acyl_Trfase/lysoPLipase       
IPR032821   KAsynt_C_assoc       
IPR042104   PKS_dehydratase_sf       
IPR011032   GroES-like_sf       
IPR001031   Thioesterase       
IPR014043   Acyl_transferase       
IPR036291   NAD(P)-bd_dom_sf       
IPR018201   Ketoacyl_synth_AS       
IPR013968   PKS_KR       
IPR013149   ADH_C       
IPR036736   ACP-like_sf       
IPR009081   PP-bd_ACP       
IPR020806   PKS_PP-bd       
IPR020846   MFS_dom       
IPR036259   MFS_trans_sf       
IPR011701   MFS       
IPR006162   Ppantetheine_attach_site       
SUPFAM
SSF53474   SSF53474        + More
SSF53901   SSF53901       
SSF51735   SSF51735       
SSF52151   SSF52151       
SSF55048   SSF55048       
SSF50129   SSF50129       
SSF47336   SSF47336       
SSF103473   SSF103473       
PDB
3HHD     E-value=5.80359e-50,     Score=495

Ontologies

Topology

Length:
203
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0318700000000001
Exp number, first 60 AAs:
0.03166
Total prob of N-in:
0.03854
outside
1  -  203
 
 

Population Genetic Test Statistics

Pi
7.183115
Theta
18.974449
Tajima's D
-1.596483
CLR
13.265294
CSRT
0.047747612619369
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号