SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO11028
Annotation
PREDICTED:_piggyBac_transposable_element-derived_protein_4-like?_partial_[Polistes_dominula]
Location in the cell
Nuclear   Reliability : 4.759
 

Sequence

CDS
ATGTCAGCAAAAAGTTCAAAGAAACGTCCAAAAATACGCTTGTTCGACGATTTTTCATCAAATTCGCCATCTGAAGCAGATTTAGATCCCTTCGAGGATAATGACGGTGATTATGGTTCTGACACGAACTATGAACCACAAAATATAGAAGAAACTGGTGCATCCAGTTCATCAGAGGAAATATTTTCTATAAGACCTCGTCGAATTATATCTGGAGGCCCTGTGGCTTCATCGGATTCAAGTAAGTCTGATATCTCAATTAGAAGTTCAGATTCTGATCAGGACGATAGAACTATCGAAAATGCTGAACCGATTTCCGAATCAGTAGACGACTTACCATCCCTTCTTATATCTCAACATGACAATGATATAGATTCAGAACCAGTGCAAAATCGGATAAGATCTCCTGTACCAGAGGAGATACCGTGGTTACATAGCACAGAAGAAATACCTGATTTTGAATTCGATGTCGAGTCATATGGCGTTCAGTTTGACGTTACCTCTCAGACTAGCATTGAACAAATTTTCGATCACGTGTTTCCAAAAGAGTTACTCGAGTACCTGGTCCAGTGTACTAATAATTATGGTACAGCTTTGTGTCAGTCAAACAAACCGTCAACCCGATATTCCCGGTCTCAAAATTTTCGAAATACTACGACTGTTGAGATGAAAAAGTTTCTTGGACTTTCGTTATTACATGGACATATTCGCACTCCTAAACAACAAAAACTATTTACTTATGATGATCCACTATATTATCATCCTGTGTTCTCATATACAATGTCTTCGCGGCGATATGAACAGATACTTCGATGTATATGTTGTTCAGAACTGGATGCAAAAGGCGCAGAAAAGATTAACAAATTTGTTGATTTGTTGACATTGAATTTTAGAAAGATATACAAACCTGATAAAGAGCTTAGTTTAGATGAATCTTTACTATTGTATCGAGGCCGACTTCACTTTCGGCAGTACATAAAGTCCAAAAAAGCAAGATATGGGATTAAATTCTATGTCTTGGCAACGGCTGATGGTTATGTTCTTAATATAATAATGTATAGCGGAAAAGACGAGAATACCCAATTGAGAGGTGTAACGAAGCTTGAACGGTTGGTAATGCGATTGATGAGACCGTTTTTATTGAAAGGACATCACCTCTTCATGGATAATTACTACAATTCGGTCACTCTTTCTCAGAAACTTTTTGATTTGAAAACCCATACAAATGGTACTCTTCGTGTTAATAGAAAAGATAATCCAAAGGAAGTAGTGGACAGAAAATTAAAAAAAGGTGATCATGTTTGGGTAAGGAAAAATAAAGTGTATGTTAGCAAATGGGTTGATAAGCGACCAGTGATTATGTTGACCACTAGAGAACACCCCCGTATTATAGAAACAACAAACAGGTTTGGGAAAATAGTTAAGAAGCCTATTGAAGTAGCAACATATAATAAATACATGTCCGGTGTAGATAGGTCTGACCAGATGATAAGTTACTATTCTTCGCCGAGGAAAACTATACGCTGGTACAAAAAAGTACTTTTTCATCTTTTGGATACCGCTGTATGGAATTCCTATTACTTATACAAGAAATTTGTACTGAAAAACCCAAAATATGAGTTATCTTCATATCGGGAGGAGTTAATAAAAAAATTAATAGATTTGAAAGAAAACTGTAAGGGTAAAGATTTAGTATTAGATTTAAAAAAACACAATAGCAGAAAACACAATAACCCCCAAAAGAACATATTTGCAGATCAAGAACGAAAATTTTGGGGTCATTGGCCCAAACGCCAACCTGCACCTGAAAATTCTAAGAAAAAATACTCATTTCTGATGTGTAAAATGTGTTCCAAGAATAAGAAGAGGGTCGAAACTAGCTACAGGTGCATTGGTTGTCCAGGACTTCCTCCATTATGTCCTGAATGTTTCCAGGATTATCACCAAATTCTTGAACAGCAAGAACAATAA
Protein
MSAKSSKKRPKIRLFDDFSSNSPSEADLDPFEDNDGDYGSDTNYEPQNIEETGASSSSEEIFSIRPRRIISGGPVASSDSSKSDISIRSSDSDQDDRTIENAEPISESVDDLPSLLISQHDNDIDSEPVQNRIRSPVPEEIPWLHSTEEIPDFEFDVESYGVQFDVTSQTSIEQIFDHVFPKELLEYLVQCTNNYGTALCQSNKPSTRYSRSQNFRNTTTVEMKKFLGLSLLHGHIRTPKQQKLFTYDDPLYYHPVFSYTMSSRRYEQILRCICCSELDAKGAEKINKFVDLLTLNFRKIYKPDKELSLDESLLLYRGRLHFRQYIKSKKARYGIKFYVLATADGYVLNIIMYSGKDENTQLRGVTKLERLVMRLMRPFLLKGHHLFMDNYYNSVTLSQKLFDLKTHTNGTLRVNRKDNPKEVVDRKLKKGDHVWVRKNKVYVSKWVDKRPVIMLTTREHPRIIETTNRFGKIVKKPIEVATYNKYMSGVDRSDQMISYYSSPRKTIRWYKKVLFHLLDTAVWNSYYLYKKFVLKNPKYELSSYREELIKKLIDLKENCKGKDLVLDLKKHNSRKHNNPQKNIFADQERKFWGHWPKRQPAPENSKKKYSFLMCKMCSKNKKRVETSYRCIGCPGLPPLCPECFQDYHQILEQQEQ

Summary

Pfam
PF13843   DDE_Tnp_1_7        + More
PF13842   Tnp_zf-ribbon_2
Interpro
IPR029526   PGBD        + More
IPR032718   PGBD4_C_Znf-ribbon       
IPR013087   Znf_C2H2_type       
IPR036236   Znf_C2H2_sf       
SUPFAM
SSF57667   SSF57667       

Ontologies

Topology

Length:
656
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
3.12823
Exp number, first 60 AAs:
0
Total prob of N-in:
0.14249
outside
1  -  656
 
 

Population Genetic Test Statistics

Pi
205.222643
Theta
148.988721
Tajima's D
1.186448
CLR
1.373349
CSRT
0.712864356782161
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号