SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10831
Annotation
endonuclease_and_reverse_transcriptase-like_protein_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.432
 

Sequence

CDS
ATGATGGGGCGAGTCTCCGAATGGGGTGAATTGAACTTGGTTCAATTCAACCCGATAAAGACACAAGTTTGCGCGTTCACTGCGAAGAAGGACCCCTTTGTCATGGCGCCGCAATTCCAAGGAGTATCCCTGCAACCTTCCGAGAGTATCGGGATACTTGGGGTCGACATTTCGAGCGATGTCCAGTTTCGGAGTCATTTGGAAGGCAAAGCCAAGTTGGCGTCCAAAATGCTGGGAGTCCTCAACAGAGCGAAGCGGTACTTCACGCCTGGACAAAGACTTTTGCTTTATAAAGCACAAGTCCGGCCTCGCATGGAGTACTGCTCCCATCTCTGGGCCGGGGCTCCCAAATACCAGCTTCTTCCATTTGACTCCATACAGAGGAGGGCCGTTCGGATTGTCGATAATCCCATTCTCTCGGATCGTTTGGAGCCTCTGGGTCTGCGGAGGGACTTCGGTTCCCTCTGTATTTTGTACCGTATGTTCCATGGGGAGTGCTCTGAGGAATTGTTCGAGATGATACCAGCATCTCGTTTTTACCATCGCACCGCCCGCCACCGGAGTAGAGTTCATCCATACTACCTGGAGCCACTGCGGTCATCCACAGTGCGTTTCCAGAGATCTTTTTTGCCACGTACCATCCGGCTATGGAATGAGCTCCCCTCCACGGTGTTTCCCGAGCGCTATGACATGTCCTTCTTCAAACGAGGCTTATGGAGAGTATTAAGCGGTAGGCAGCGGCTTGGCTCTGCCCCTGGCATTGCTGAAGTCCATGGGCGACGGTAA
Protein
MMGRVSEWGELNLVQFNPIKTQVCAFTAKKDPFVMAPQFQGVSLQPSESIGILGVDISSDVQFRSHLEGKAKLASKMLGVLNRAKRYFTPGQRLLLYKAQVRPRMEYCSHLWAGAPKYQLLPFDSIQRRAVRIVDNPILSDRLEPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVLSGRQRLGSAPGIAEVHGRR

Summary

Similarity
Belongs to the protein kinase superfamily. Tyr protein kinase family.
EMBL
AY359886    AAQ57129.1    AB126052    BAD86652.1    RSAL01002067    RVE40593.1    + More
RSAL01000487    RVE41561.1    RSAL01000164    RVE45343.1    RSAL01003136    RVE40332.1    RSAL01000002    RVE55041.1    RVE55094.1    RVE54942.1    ODYU01002162    SOQ39302.1    RSAL01000422    RVE41792.1    RSAL01000090    RVE48098.1    ODYU01007423    SOQ50184.1    AMCI01002135    EJX03495.1    GDRN01105059    JAI57791.1    HAAD01001474    CDG67706.1    DPOC01000269    HCX22453.1    LWDP01000391    ORD92879.1    RSAL01000193    RVE44603.1    RSAL01000030    RVE51708.1    GFAC01000919    JAT98269.1    GEGO01001118    JAR94286.1    GEFM01002394    JAP73402.1    MRZV01001153    PIK40187.1    GBIH01002577    JAC92133.1    JH815916    EKC31648.1    GANP01010920    JAB73548.1    GFAA01002657    JAU00778.1    GFAA01002514    JAU00921.1    GFAA01002479    JAU00956.1    GEFM01006417    JAP69379.1    GFAC01005665    JAT93523.1    GEGO01004630    JAR90774.1    GFAC01005646    JAT93542.1    GEGO01002473    JAR92931.1    GEFM01002324    JAP73472.1    GADI01001229    JAA72579.1    GEGO01004433    JAR90971.1    GEFM01006320    JAP69476.1    GEFM01001453    JAP74343.1    GEFM01005882    JAP69914.1    GBBK01004986    JAC19496.1    LSMT01000297    PFX20951.1    GEGO01003111    JAR92293.1    GFAA01000199    JAU03236.1    GDRN01111277    JAI56804.1    GFAC01005670    JAT93518.1    GEFM01002419    JAP73377.1    GEGO01005479    JAR89925.1    GANP01010944    JAB73524.1    GEFM01006250    JAP69546.1    GEGO01003518    JAR91886.1    MRZV01000639    PIK46517.1    NSIT01000239    PJE78188.1    AAGJ04028970    GFAA01004201    JAT99233.1    GEGO01003312    JAR92092.1    GEGO01004295    JAR91109.1    AAGJ04019135    FLMD02000280    SCV66640.1    GEFM01006421    JAP69375.1    AAGJ04106435    NEDP02002733    OWF50189.1    GFAA01003161    JAU00274.1    GEGO01003427    JAR91977.1    GFPF01007594    MAA18740.1    GFAA01003546    JAT99888.1    AGCU01117142    GEFM01001613    JAP74183.1    QRBI01000123    RMC05275.1    FLMD02000154    SCV66010.1    NSIT01000412    PJE77717.1    KK734351    KFR06808.1    GEGO01003776    JAR91628.1    GEGO01002025    JAR93379.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF01873   eIF-5_eIF-2B
PF01585   G-patch
PF04939   RRS1
PF08159   NUC153
PF00458   WHEP-TRS
PF07714   Pkinase_Tyr
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR016190   Transl_init_fac_IF2/IF5_Zn-bd       
IPR002735   Transl_init_fac_IF2/IF5       
IPR016189   Transl_init_fac_IF2/IF5_N       
IPR012677   Nucleotide-bd_a/b_plait_sf       
IPR000504   RRM_dom       
IPR034653   SPF45_RRM       
IPR003954   RRM_dom_euk       
IPR000467   G_patch_dom       
IPR040052   RBM17       
IPR035979   RBD_domain_sf       
IPR007023   Ribosom_reg       
IPR036322   WD40_repeat_dom_sf       
IPR040382   NOL10/Enp2       
IPR012580   NUC153       
IPR001680   WD40_repeat       
IPR000738   WHEP-TRS_dom       
IPR009068   S15_NS1_RNA-bd       
IPR000719   Prot_kinase_dom       
IPR008266   Tyr_kinase_AS       
IPR020635   Tyr_kinase_cat_dom       
IPR017441   Protein_kinase_ATP_BS       
IPR001245   Ser-Thr/Tyr_kinase_cat_dom       
IPR011009   Kinase-like_dom_sf       
IPR028082   Peripla_BP_I       
SUPFAM
SSF56219   SSF56219        + More
SSF75689   SSF75689       
SSF100966   SSF100966       
SSF54928   SSF54928       
SSF50978   SSF50978       
SSF47060   SSF47060       
SSF56112   SSF56112       
SSF53822   SSF53822       
Gene 3D

Ontologies

Topology

Length:
261
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.000630000000000001
Exp number, first 60 AAs:
0.00041
Total prob of N-in:
0.03686
outside
1  -  261
 
 

Population Genetic Test Statistics

Pi
38.831972
Theta
62.993549
Tajima's D
0.253913
CLR
0.019942
CSRT
0.444177791110444
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号