SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10820  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA008445
Annotation
PREDICTED:_indole-3-acetaldehyde_oxidase-like_isoform_X2_[Bombyx_mori]
Location in the cell
Extracellular   Reliability : 2.879
 

Sequence

CDS
ATGTCGCTAAATGCGTACATCAGATACGTGTGTGGTCTGACCGGGACTAAGGCGATGTGCCGTGAAGGAGGCTGCGGTGCTTGCATCGTCACAGTACGAGCCAAACGGTATCCCAGTGGAAAGACTGAAACATTTTCCGTAAATTCGTGTCTCGTGCTTGTATTTTCGTGTCACGGTTGGGATATAAGGACAATCGAAAGCACTGGTAATAGATTGGACGGGTACAGTGATATTCAGAAACTCACCGCTTGTTTACACGGAACCCAGTGTGGGTATTGCACACCCGGGTGGATTATGCACTTGAATAGGTGA
Protein
MSLNAYIRYVCGLTGTKAMCREGGCGACIVTVRAKRYPSGKTETFSVNSCLVLVFSCHGWDIRTIESTGNRLDGYSDIQKLTACLHGTQCGYCTPGWIMHLNR

Summary

Cofactor
FAD
Mo-molybdopterin
[2Fe-2S] cluster
Similarity
Belongs to the UDP-glycosyltransferase family.
EMBL
KY643683    AQY62686.1    BABH01001678    BABH01001679    ODYU01007852    SOQ50986.1    + More
KP899547    AKQ06146.1    LC017754    BAR64768.1    KF960796    AII21998.1    ODYU01009314    SOQ53643.1    NWSH01000022    PCG80663.1    KC952900    AGQ43599.1    KQ459606    KPI90901.1    GEYN01000002    JAV02127.1    AGBW02010767    OWR47879.1    ODYU01002537    SOQ40155.1    ODYU01001109    SOQ36868.1    KF960794    AII21996.1    GEYN01000003    JAV02126.1    NWSH01000413    PCG76559.1    PCG76561.1    PCG76560.1    BABH01001661    EU073424    ABW71272.1    LC017753    BAR64767.1    RSAL01000229    RVE43893.1    LC017752    BAR64766.1    KY595779    ARS46833.1    KF960795    AII21997.1    PCG76558.1    KY595778    ARS46832.1    KPI90909.1    AY947538    AAY22446.1    KQ461196    KPJ06623.1    KPJ06614.1    GEYN01000001    JAV02128.1    BABH01001657    BABH01001658    BABH01001659    BABH01001660    EU073423    ABW71271.1    LC017757    BAR64771.1    ODYU01004253    SOQ43930.1    AGBW02008082    OWR54176.1    NWSH01004179    PCG65395.1    AGBW02009901    OWR49607.1    KP899546    AKQ06145.1    KK853740    KDQ87993.1    GBHO01014555    GBHO01014552    JAG29049.1    JAG29052.1    GDHC01015520    JAQ03109.1    GBHO01014557    GBHO01014554    GBRD01002756    JAG29047.1    JAG29050.1    JAG63065.1    GDHC01013650    GDHC01001960    JAQ04979.1    JAQ16669.1    KY595781    ARS46835.1    KQ460556    KPJ13979.1    LNIX01000001    OXA64068.1    AXCN02000553    AXCN02000554    UFQS01000745    UFQT01000745    SSX06553.1    SSX26900.1    GEDC01006998    JAS30300.1    GBBI01004413    JAC14299.1    RSAL01000295    RVE42846.1    GANO01002236    JAB57635.1    KK855082    PTY20711.1    AXCM01011484    KK855424    PTY22515.1    GBRD01017213    JAG48614.1    ODYU01001472    SOQ37709.1    ACPB03000354    ACPB03000355    GBRD01017212    JAG48615.1    KP859407    AKZ17717.1    NEVH01020852    PNF21139.1    AJWK01034051    ODYU01006502    SOQ48394.1    ADMH02001746    ETN61219.1    CH477659    EJY57867.1    LC017759    BAR64773.1    LJIJ01000015    ODN05821.1    ACPB03005165    KPI90950.1    KA644981    AFP59610.1    GBXI01006684    JAD07608.1    LJIJ01000032    ODN04991.1    ODN05815.1    KQ979701    KYN19698.1    GEDC01004862    JAS32436.1    APCN01000032    AJWK01012074    AJWK01012075    AAAB01008960    EDO63837.1    EDO63836.1    GGFL01002295    MBW66473.1    ETN61221.1    ODYU01000882    SOQ36316.1   
Pfam
PF02738   Ald_Xan_dh_C2        + More
PF03450   CO_deh_flav_C
PF01315   Ald_Xan_dh_C
PF01799   Fer2_2
PF00941   FAD_binding_5
PF00111   Fer2
PF01130   CD36
PF00271   Helicase_C
PF00051   Kringle
PF00201   UDPGT
Interpro
IPR002888   2Fe-2S-bd        + More
IPR016208   Ald_Oxase/xanthine_DH       
IPR000674   Ald_Oxase/Xan_DH_a/b       
IPR036318   FAD-bd_PCMH-like_sf       
IPR036884   2Fe-2S-bd_dom_sf       
IPR005107   CO_DH_flav_C       
IPR008274   AldOxase/xan_DH_Mopterin-bd       
IPR001041   2Fe-2S_ferredoxin-type       
IPR036010   2Fe-2S_ferredoxin-like_sf       
IPR036683   CO_DH_flav_C_dom_sf       
IPR006058   2Fe2S_fd_BS       
IPR016166   FAD-bd_PCMH       
IPR002346   Mopterin_DH_FAD-bd       
IPR037165   AldOxase/xan_DH_Mopterin-bd_sf       
IPR036856   Ald_Oxase/Xan_DH_a/b_sf       
IPR016169   FAD-bd_PCMH_sub2       
IPR012675   Beta-grasp_dom_sf       
IPR002159   CD36_fam       
IPR027417   P-loop_NTPase       
IPR002464   DNA/RNA_helicase_DEAH_CS       
IPR014001   Helicase_ATP-bd       
IPR001650   Helicase_C       
IPR035595   UDP_glycos_trans_CS       
IPR013806   Kringle-like       
IPR038178   Kringle_sf       
IPR000001   Kringle       
IPR041775   Ror-like_CRD       
IPR020067   Frizzled_dom       
IPR036790   Frizzled_dom_sf       
IPR002213   UDP_glucos_trans       
SUPFAM
SSF47741   SSF47741        + More
SSF56003   SSF56003       
SSF56176   SSF56176       
SSF55447   SSF55447       
SSF54292   SSF54292       
SSF54665   SSF54665       
SSF52540   SSF52540       
SSF57440   SSF57440       
PDB
1JRP     E-value=2.51494e-12,     Score=167

Ontologies

Topology

Length:
103
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.31406
Exp number, first 60 AAs:
0.24388
Total prob of N-in:
0.41454
outside
1  -  103
 
 

Population Genetic Test Statistics

Pi
57.589766
Theta
147.052536
Tajima's D
-1.144841
CLR
1690.196852
CSRT
0.113294335283236
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号