SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10802
Annotation
PREDICTED:_uncharacterized_protein_LOC101737585_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 1.213
 

Sequence

CDS
ATGAGACGAGCCTTAGATGGCTGGGAGGGTGGAGTGTCCATTGGCGGCAGGAAAATCAGTAATCTCCGTTATGCAGTTGGCACCACACTGCTCGCATCATCCGAGCAAGAACTAGCCCAACTCTTTACTAGGGTGGCGGAGGAGAGAGAATTAGTTGGCCTAACCATTAATAAGGCGAAGACCAAGGTATTGATGGTGGACAGACCCGGTATGCTTATTCGCTCTAATCAACTTCATGACTTGGAATTTGTTGACCAGTTCGTTTATCTTGGCTCTCTTCTTTGTGGTGAGGGTGGCAGCGAGAAAGAGATAGCTAGAAATTCAAATTCAATATGTCAAAATGAAGAAGCCAAATGTCCAAAGGAGCAATGA
Protein
MRRALDGWEGGVSIGGRKISNLRYAVGTTLLASSEQELAQLFTRVAEERELVGLTINKAKTKVLMVDRPGMLIRSNQLHDLEFVDQFVYLGSLLCGEGGSEKEIARNSNSICQNEEAKCPKEQ

Summary

Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
Interpro
IPR005135   Endo/exonuclease/phosphatase        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR000477   RT_dom       
IPR002138   Pept_C14_p10       
SUPFAM
SSF56219   SSF56219       
Gene 3D

Ontologies

Topology

Length:
123
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00397
Exp number, first 60 AAs:
0.0034
Total prob of N-in:
0.20171
outside
1  -  123
 
 

Population Genetic Test Statistics

Pi
473.726108
Theta
203.232577
Tajima's D
4.189665
CLR
0.418183
CSRT
0.999650017499125
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号