SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10773
Pre Gene Modal
BGIBMGA008395
Annotation
PREDICTED:_delta-like_protein_1_[Bombyx_mori]
Full name
Delta-like protein       + More
Delta-like protein B      
Delta-like protein C      
Location in the cell
Extracellular   Reliability : 2.136
 

Sequence

CDS
ATGTTGTCACTACCAAATTTAGAACCAATTTGTGCAGCGAACTGTCACAGCGAGAGGGGCTTCTGTCGGCGTCCCGGGGAATGCCGCTGCAAGGTCGGCTGGACCGGGCCCACGTGCGCGCAGTGCCACAGGTACCCTGGCTGCAAGCACGGAACTTGCAGGAAGCCTTGGGAGTGTATCTGCAAAAAGGGCTGGGGAGGAATGCTGTGTGACGAAGGTGAGTTTTAA
Protein
MLSLPNLEPICAANCHSERGFCRRPGECRCKVGWTGPTCAQCHRYPGCKHGTCRKPWECICKKGWGGMLCDEGEF

Summary

Description
Putative Notch ligand involved in the mediation of Notch signaling.
Acts as a ligand for Notch receptors and is involved in primary neurogenesis. Can activate Notch receptors, thereby playing a key role in lateral inhibition, a process that prevents the immediate neighbors of each nascent neural cell from simultaneously embarking on neural differentiation.
Acts as a ligand for Notch receptors and is involved in somitogenesis. Can activate Notch receptors. Required in somite segmentation to keep the oscillations of neighboring presomitic mesoderm cells synchronized.
Keywords
Calcium   Complete proteome   Developmental protein   Differentiation   Disulfide bond   EGF-like domain   Glycoprotein   Membrane   Neurogenesis   Notch signaling pathway   Reference proteome   Repeat   Signal   Transmembrane   Transmembrane helix   Ubl conjugation  
Feature
chain  Delta-like protein
EMBL
BABH01001586    BABH01001587    BABH01001588    RSAL01000295    RVE42832.1    ODYU01002872    + More
ODYU01002873    SOQ40891.1    SOQ40893.1    NWSH01000842    PCG73890.1    KQ459606    KPI90936.1    AK401351    BAM17973.1    KQ460556    KPJ13994.1    AGBW02012556    OWR44831.1    NEVH01013241    PNF29570.1    ADMH02000906    ETN64702.1    AJVK01059319    CH477238    EAT46528.1    UFQT01000011    SSX17592.1    GDHF01033893    GDHF01016277    GDHF01008994    JAI18421.1    JAI36037.1    JAI43320.1    GBXI01013973    GBXI01005251    JAD00319.1    JAD09041.1    GAKP01000440    JAC58512.1    KB630786    ERL83870.1    APCN01001416    JXUM01061469    JXUM01061470    KQ562151    KXJ76561.1    AXCM01004569    KQ971338    EFA01689.2    AAAB01008823    EAA05540.4    KK852478    KDR23028.1    ATLV01025458    KE525389    KFB52403.1    GGMR01013275    MBY25894.1    GDHF01007062    JAI45252.1    GEMB01001958    JAS01219.1    GECU01034960    JAS72746.1    AAZO01007376    DS232497    EDS42647.1    DS235882    EEB20152.1    GECZ01029758    JAS40011.1    GEBQ01012677    JAT27300.1    CCAG010014160    GAMC01015674    GAMC01015667    JAB90888.1    GAMC01015673    GAMC01015668    JAB90887.1    ABLF02037278    GGMS01004273    MBY73476.1    BT128007    AEE62969.1    GFXV01007880    MBW19685.1    KB632126    ERL88955.1    JRES01000955    KNC26803.1    GEZM01083945    JAV60920.1    OUUW01000025    SPP89614.1    CH479209    EDW32701.1    CH963851    EDW75069.2    JH431265    CH379064    EAL31606.2    CU458990    CAM73251.1    AF006488    BC076414    RJVU01055763    ROK74152.1    FR913631    CDQ92677.1    CM000162    EDX02035.1    AE014298    BT122182    AAF47984.1    ADE58552.1    CH916376    EDV95388.1    CH954180    EDV46111.1    CH940655    EDW66292.2    JH883261    ELR46918.1    AL935335    CU458991    CAM73252.1    AF146429   
Pfam
PF00008   EGF        + More
PF00053   Laminin_EGF
PF00561   Abhydrolase_1
PF07974   EGF_2
PF01414   DSL
PF12661   hEGF
PF07657   MNNL
PF03031   NIF
Interpro
IPR002049   Laminin_EGF        + More
IPR013032   EGF-like_CS       
IPR000742   EGF-like_dom       
IPR001881   EGF-like_Ca-bd_dom       
IPR001774   DSL       
IPR016024   ARM-type_fold       
IPR009030   Growth_fac_rcpt_cys_sf       
IPR029058   AB_hydrolase       
IPR000073   AB_hydrolase_1       
IPR013111   EGF_extracell       
IPR000152   EGF-type_Asp/Asn_hydroxyl_site       
IPR018097   EGF_Ca-bd_CS       
IPR011651   Notch_ligand_N       
IPR004274   FCP1_dom       
IPR036412   HAD-like_sf       
IPR023214   HAD_sf       
SUPFAM
SSF48371   SSF48371        + More
SSF57184   SSF57184       
SSF53474   SSF53474       
SSF56784   SSF56784       
Gene 3D
PDB
4XLW     E-value=1.14494e-16,     Score=205

Ontologies

Topology

Subcellular location
Membrane  
Length:
75
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.02922
outside
1  -  75
 
 

Population Genetic Test Statistics

Pi
58.110576
Theta
102.418806
Tajima's D
-1.356658
CLR
180.662552
CSRT
0.07999600019999
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号