SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10734
Annotation
PREDICTED:_uncharacterized_protein_LOC106713896?_partial_[Papilio_machaon]
Location in the cell
Mitochondrial   Reliability : 3.392
 

Sequence

CDS
ATGCTCCACCCGAAGTCCTCGGTAATGAGATTGTACATTCCGCGGAAGTGTGGTGGCCGGGGCCTACTTAGCGCCAAGGTCATGCACAACAGTGGGGTGTGCAGTCTCAGGGAATATTTCCTATCGAGGGCTGACAGTGTGATGCACAGAGAGGTCATGGAATGCGACAAAGGACTGACCCCGCTAGCCCTGGCCAGAGACGGGTGGCAATCACCGGCGGTACTCAGTACCTCTGACCGTGAGGCCATATGGAAAGGGAAAGAGCTGCACGGACGCTTCTTTCAGGCACTGCATGAGCCCCACGTGGACAAAGAAGCCTCCGTGCACTGGCTGCGATTCGGTGACCTCTTTGGGGAAACCGAGGGTTTTGTCTGTGCAATACAGGATCAGGTTATCAGGACGAACAACTATAGGAAGCACATTCTGAGGGATGGGACAGCTGACATCTGTCGATTATGCCGCCGACCGGGTGAATCCCTCAGACATGTCACCTCTGGTTGTTCTATGCTTGCTAATACTGAGTACTTGCACAGACATAACCAAGCAGCCAGAATCCTCCACCAAGAGCTCGCCCTTAAGTATGGCCTCATCGAACAGAGGCTACCGTATTATAAGTACCAGCCGGACGCTGTACTCGAAAACGACCGTGCCAAGCTCTACTGGGACCGGCCCATCATTACGGACAGGACTATTCTTGCGAATAAGCCTGATATCGTGCTGATGGACCGGACGGAGTCTCGGGTATTTCTGGTGGATATCACCATCCCCTACGACGAGAACCTCGTGCGGGCCGAGGCAGATAAAAAGACCAAATATTTGGACCTGGCGCACGAGGTGACCGACATGTGGAGGGTGGTATCTACAGAAATAATCCCGGTAGTTGTGTCGGTGAATGGTTTGGTCCCTAAAAGCCTCTCAAAACATCTCGAGAGGCTTGGTCTCAACAAAAAGTCGGTGGTGGCCCAAATGCAAAAGGCAGTCTTGCTCGATAATGCCCGTATAGTTCGCCGGTTTCTCTCCCAATAG
Protein
MLHPKSSVMRLYIPRKCGGRGLLSAKVMHNSGVCSLREYFLSRADSVMHREVMECDKGLTPLALARDGWQSPAVLSTSDREAIWKGKELHGRFFQALHEPHVDKEASVHWLRFGDLFGETEGFVCAIQDQVIRTNNYRKHILRDGTADICRLCRRPGESLRHVTSGCSMLANTEYLHRHNQAARILHQELALKYGLIEQRLPYYKYQPDAVLENDRAKLYWDRPIITDRTILANKPDIVLMDRTESRVFLVDITIPYDENLVRAEADKKTKYLDLAHEVTDMWRVVSTEIIPVVVSVNGLVPKSLSKHLERLGLNKKSVVAQMQKAVLLDNARIVRRFLSQ

Summary

Pfam
PF00078   RVT_1
Interpro
IPR000477   RT_dom        + More
IPR001611   Leu-rich_rpt       

Ontologies

Topology

Length:
341
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.02956
Exp number, first 60 AAs:
0.00208
Total prob of N-in:
0.01810
outside
1  -  341
 
 

Population Genetic Test Statistics

Pi
174.924741
Theta
20.242513
Tajima's D
3.305777
CLR
0.242829
CSRT
0.989650517474126
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号