SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10719
Pre Gene Modal
BGIBMGA008281
Annotation
PREDICTED:_ovochymase-2-like_[Bombyx_mori]
Location in the cell
Extracellular   Reliability : 1.975 PlasmaMembrane   Reliability : 2.638
 

Sequence

CDS
ATGAACGTAAAATACGGAATACTTTTTGTGGCGCTCTTTGCGGCTGCCTGGGCCCTCCCCAAGCCTGAAGATGACATGTCCATCTTCTATGAGCATGTGGACCGGAACGCTCGTATTGTGGGGGGTAGCCAGGCAGCTCAGGGCAGCCACCCCCACATGGTAGCGATGACTAATGGTATCTTCATCAGGAGCTTTGTCTGCGGAGGCTCAGTGCTCACCGCACGCACGGTGCTCACCGCTGCTCATTGCATTGCCGCTGTATTCATATTTGGAAGTCTCTCTGGAAATCTTCGTCTGACAGTCGGTACAAACCAATGGAACTCTGGTGGTACCCTCCACGCTGTCTCCAGAAACATCACCCACCCTAACTACGTGTCCAATACTATCAAGAACGACTTGGGTATTCTCATAACTTCCTCGAACATCGTCTTCAACGACCGCGTCAGGCCTATCTCTTTGAGTTTTGACTACGTACCTGGAGGCGTCCCTGTCAGGGTTGCTGGATGGGGAAGAGTTAGGGCTAACGGTGCTCTCTCCACGAATCTTCTGGAGATCAATGTGAGAACCATTGATGCTCAGACTTGCGTGAGGACTGCGGCCCAGGCGGCCATTGATCTTAACATGAGGGCTCCTCCTGTCGAACCTCACATCGAGCTCTGCACATTCCACGCAGAAGGAACTGGTACTTGCAATGGTGACAGTGGCAGCGCATTGGCTCGGACCGACAGCGGTCTCCAAGTCGGCATCGTGTCGTGGGGCTTCCCTTGCGCGCTGGGAGCTCCTGACATGTTCGTCAGAGTCAGCGCCTTCCGGTCCTGGCTGCAACAAAACATAGCTAATTAA
Protein
MNVKYGILFVALFAAAWALPKPEDDMSIFYEHVDRNARIVGGSQAAQGSHPHMVAMTNGIFIRSFVCGGSVLTARTVLTAAHCIAAVFIFGSLSGNLRLTVGTNQWNSGGTLHAVSRNITHPNYVSNTIKNDLGILITSSNIVFNDRVRPISLSFDYVPGGVPVRVAGWGRVRANGALSTNLLEINVRTIDAQTCVRTAAQAAIDLNMRAPPVEPHIELCTFHAEGTGTCNGDSGSALARTDSGLQVGIVSWGFPCALGAPDMFVRVSAFRSWLQQNIAN

Summary

Similarity
Belongs to the peptidase S1 family.
EMBL
BABH01035039    BABH01035040    JQ081296    AFD99127.1    BABH01035036    BABH01035037    + More
EU325548    KZ150045    ACB54938.1    PZC74508.1    EF531620    ABR88231.1    AM419170    CAL92020.1    NWSH01004418    PCG65143.1    FJ205415    ACR15983.2    ODYU01004616    SOQ44682.1    KP690082    ODYU01004615    ALO61084.1    SOQ44680.1    PCG65142.1    AM690448    CAM84318.1    AM690449    CAM84319.1    KQ459606    KPI90986.1    ODYU01008037    SOQ51306.1    BABH01035035    HM990181    ADT80829.1    ODYU01002608    SOQ40331.1    JQ904145    AFM77775.1    GDQN01000207    JAT90847.1    AM690447    CAM84317.1    KQ460326    KPJ15683.1    ODYU01002379    SOQ39797.1    GDQN01009632    JAT81422.1    RSAL01000088    RVE48198.1    SOQ40332.1    AGBW02010744    OWR47925.1    SOQ39799.1    KPJ15684.1    ODYU01001513    SOQ37833.1    KPI90987.1    AGBW02008493    OWR53226.1    OWR47924.1    JTDY01001984    KOB72401.1    SOQ40333.1    AGBW02008353    OWR53602.1    KPJ15682.1    KPI90985.1    SOQ39798.1    JTDY01001141    KOB74753.1    ODYU01009947    SOQ54703.1    RVE48200.1    ODYU01010616    SOQ55846.1    BABH01035041    OWR53227.1    GDQN01005253    JAT85801.1    NWSH01000498    PCG76020.1    JTDY01003392    KOB69628.1    JQ904144    AFM77774.1    PZC74510.1    AY820894    AAX35812.1    KPI90984.1    AGBW02009869    OWR49695.1    ODYU01013016    SOQ59625.1    PCG65144.1    PZC74509.1    SOQ59627.1    KPJ15681.1    GFDL01004672    JAV30373.1    OWR49696.1    KQ434827    KZC07503.1    GL434905    EFN74332.1    AJVK01029631    AF053903    AAD21823.1    DS232137    EDS35878.1    GFDL01008064    JAV26981.1    GFDL01005774    JAV29271.1    RSAL01000269    RVE43195.1    GAPW01003508    JAC10090.1    DS232962    DS231983    EDS27062.1    EDS30402.1    AF487334    AAL93243.1    KK107109    QOIP01000008    EZA59134.1    RLU19794.1    AF051780    AAD17493.1    APCN01002347    AAAB01008807    EAA45498.1    GL438568    EFN68767.1    ADMH02001109    ETN64084.1    DS231933    EDS27558.1    KQ435756    KOX75917.1    GAPW01003418    JAC10180.1    GEHC01000393    JAV47252.1    BABH01018411    GAMD01002746    JAA98844.1    EU035826    ABV44728.1    KZ288229    PBC31726.1    LBMM01004589    KMQ92263.1    GEZM01027546    JAV86682.1    NNAY01001573    OXU23549.1    AGBW02010081    OWR49201.1    LBMM01013914    KMQ85419.1    GGFL01005406    MBW69584.1   
Pfam
PF00089   Trypsin
Interpro
IPR001314   Peptidase_S1A        + More
IPR009003   Peptidase_S1_PA       
IPR018114   TRYPSIN_HIS       
IPR001254   Trypsin_dom       
IPR033116   TRYPSIN_SER       
IPR012224   Pept_S1A_FX       
SUPFAM
SSF50494   SSF50494       
PDB
1EQ9     E-value=6.26002e-31,     Score=333

Ontologies

Topology

SignalP
Position:   1 - 18,         Likelihood:  0.995283
 
 
Length:
280
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
33.6976000000001
Exp number, first 60 AAs:
13.73001
Total prob of N-in:
0.80984
POSSIBLE N-term signal
sequence
outside
1  -  280
 
 

Population Genetic Test Statistics

Pi
215.123743
Theta
159.830477
Tajima's D
1.12565
CLR
1.354785
CSRT
0.687015649217539
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号