SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10717
Pre Gene Modal
BGIBMGA008279
Annotation
PREDICTED:_ovochymase-2-like_[Bombyx_mori]
Location in the cell
Extracellular   Reliability : 2.194
 

Sequence

CDS
ATGGAAGTCGGTACAAACCAATTTATCTCTGGAGGTGCTATCCACACTGTCTCCAGAAACATCAGCCACCCTCACTACGTCTCCAACACCATCAAGAACGACTTGGGTATTCTCATAACTTCCTCGGACATCGTTTTCAACAACCGCGTCAGGCCTATCTCTTTGAGTTTTGACTACGTACCTGGAGGCGTCCCTGTCAGGGTTGCTGGATGGGGAAGAGTTGGGGCTAACGGTGCTCTCTCCATGAATCTTCTGGAGATCAATGTGAGAACCATTGACGGTCAGTCTTGCGTGAGGGCTGTGGCCCAGGCGGCCATTGACTTTAATGTAAGGGCTCTTCCTGTCGAACCTCACATCGAACTCTGCACATTCCACGCAGAAGGAACTGGTACTTGCAACGGTGACAGTGGCAGCGCATTGGCTCGGACCGACAACGGTCTCCAAGTCGGCATCGTGTCGTGGGGCTTCCCTTGCGCGGTGGGAGCTCCTGACATGTTCGTCAGAGTCAGCGCCTTCCGGTCCTGGCTGCAACAAAACATCAGCTAA
Protein
MEVGTNQFISGGAIHTVSRNISHPHYVSNTIKNDLGILITSSDIVFNNRVRPISLSFDYVPGGVPVRVAGWGRVGANGALSMNLLEINVRTIDGQSCVRAVAQAAIDFNVRALPVEPHIELCTFHAEGTGTCNGDSGSALARTDNGLQVGIVSWGFPCAVGAPDMFVRVSAFRSWLQQNIS

Summary

Similarity
Belongs to the peptidase S1 family.
EMBL
BABH01035036    JQ081296    AFD99127.1    BABH01035039    BABH01035040    BABH01035037    + More
NWSH01004418    PCG65142.1    EF531620    ABR88231.1    PCG65143.1    EU325548    KZ150045    ACB54938.1    PZC74508.1    AM419170    CAL92020.1    ODYU01004616    SOQ44682.1    KP690082    ODYU01004615    ALO61084.1    SOQ44680.1    FJ205415    ACR15983.2    AM690449    CAM84319.1    KQ459606    KPI90986.1    JQ904145    AFM77775.1    HM990181    ADT80829.1    GDQN01000207    JAT90847.1    AM690448    CAM84318.1    GDQN01009632    JAT81422.1    ODYU01008037    SOQ51306.1    ODYU01002608    SOQ40331.1    BABH01035035    AM690447    CAM84317.1    KQ460326    KPJ15683.1    RSAL01000088    RVE48198.1    KPJ15684.1    KPI90987.1    AGBW02010744    OWR47925.1    ODYU01002379    SOQ39797.1    ODYU01001513    SOQ37833.1    SOQ39799.1    AGBW02008493    OWR53226.1    SOQ40332.1    JTDY01001984    KOB72401.1    AGBW02008353    OWR53602.1    KPJ15682.1    RVE48200.1    KPI90985.1    OWR47924.1    BABH01035041    SOQ40333.1    OWR53227.1    JTDY01001141    KOB74753.1    NWSH01000498    PCG76020.1    SOQ39798.1    JTDY01003392    KOB69628.1    GDQN01006140    JAT84914.1    GDQN01005253    JAT85801.1    PCG65144.1    AY820894    AAX35812.1    PZC74510.1    KPI90984.1    KPJ15681.1    ODYU01013016    SOQ59625.1    KQ434827    KZC07503.1    PZC74509.1    KQ461195    KPJ06629.1    SOQ59627.1    AGBW02014066    OWR42328.1    JQ904144    AFM77774.1    AF053903    AAD21823.1    KZ150244    PZC71884.1    AGBW02009869    OWR49696.1    NWSH01000497    PCG76022.1    ODYU01010616    SOQ55846.1    GL434905    EFN74332.1    CH477816    EAT35959.1    GU018015    ACY24348.1    ODYU01009947    SOQ54703.1    GFDL01004672    JAV30373.1    DS232137    EDS35878.1    KQ435756    KOX75917.1    RSAL01000269    RVE43195.1    KQ459596    KPI95439.1    ODYU01011093    SOQ56615.1    KZ150012    PZC75048.1    LBMM01013914    KMQ85419.1    GL438568    EFN68767.1    LBMM01004589    KMQ92263.1    ADMH02000120    ETN67726.1    OWR49695.1    KK107109    QOIP01000008    EZA59134.1    RLU19794.1    AJVK01029631    GGFL01005406    MBW69584.1    NWSH01000128    PCG79273.1    GEZM01021211    JAV89084.1    CH477398    EAT41784.1    RSAL01000014    RVE53228.1    CVRI01000066    CRL06219.1    KQ759888    OAD62114.1    KQ978317    KYM95214.1    KQ982174    KYQ59316.1    AJWK01010930    AJWK01010931    AJWK01010932    AGBW02010081    OWR49201.1    NNAY01001573    OXU23549.1   
Pfam
PF00089   Trypsin
Interpro
IPR001314   Peptidase_S1A        + More
IPR009003   Peptidase_S1_PA       
IPR001254   Trypsin_dom       
IPR018114   TRYPSIN_HIS       
IPR033116   TRYPSIN_SER       
IPR012224   Pept_S1A_FX       
SUPFAM
SSF50494   SSF50494       
PDB
1EQ9     E-value=4.54099e-20,     Score=236

Ontologies

Topology

Length:
181
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.63435
Exp number, first 60 AAs:
0.00457
Total prob of N-in:
0.09199
outside
1  -  181
 
 

Population Genetic Test Statistics

Pi
255.100692
Theta
62.699306
Tajima's D
0.307362
CLR
0.158176
CSRT
0.463426828658567
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号