SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10716
Pre Gene Modal
BGIBMGA008278
Annotation
PREDICTED:_LOW_QUALITY_PROTEIN:_chymotrypsin-2-like_[Bombyx_mori]
Location in the cell
Extracellular   Reliability : 2.098 PlasmaMembrane   Reliability : 1.436
 

Sequence

CDS
ATGTCCATATTCTACAAGCACGCTGACCGAAACGCTCGTATCGTGGGAGGGACCCCAGCGGCTCGCGGCAGCCATCCTCATATGGTCGCTATGACCAAAAATTTTCTCATCAGGAGCTTAGTCTGCGGAGGATCATTGGTCACTCCTCGTACCGTACTCACGGCTGCCCATTGTATAGCTTCGGTCTTTTCTTCAGGTGCTCTGTCTAGTTCCCTGCGCGTGGTGGTCGGCACCAATCAATGGAACTCCGGTGGCCAGATCTACGCTGTCGCTAGAAACATCACACATCCAAACTACGTATCTCAAACATTAAAGAACGATCTAGGTCTCCTCATCACCACTTCTGATGTAGAGTATAATGACCTAGTCAGACCAATTGCATTGAACGATTCATTCCAAGTGGTTTTCCGGTCAGGGTTGCTGGATGGGGCAGGATTGGGGTAA
Protein
MSIFYKHADRNARIVGGTPAARGSHPHMVAMTKNFLIRSLVCGGSLVTPRTVLTAAHCIASVFSSGALSSSLRVVVGTNQWNSGGQIYAVARNITHPNYVSQTLKNDLGLLITTSDVEYNDLVRPIALNDSFQVVFRSGLLDGAGLG

Summary

Similarity
Belongs to the peptidase S1 family.
EMBL
BABH01035035    BABH01035036    BABH01035039    BABH01035040    JQ081296    AFD99127.1    + More
BABH01035037    FJ205415    ACR15983.2    NWSH01004418    PCG65142.1    ODYU01004616    SOQ44682.1    KP690082    ODYU01004615    ALO61084.1    SOQ44680.1    EF531620    ABR88231.1    PCG65143.1    EU325548    KZ150045    ACB54938.1    PZC74508.1    ODYU01012479    SOQ58810.1    ODYU01008037    SOQ51306.1    KQ459606    KPI90986.1    HM990181    ADT80829.1    KQ460326    KPJ15683.1    JQ904145    AFM77775.1    GDQN01000207    JAT90847.1    AM690449    CAM84319.1    AM690448    CAM84318.1    AM690447    CAM84317.1    AM419170    CAL92020.1    ODYU01002608    SOQ40331.1    JTDY01001141    KOB74753.1    RSAL01000088    RVE48198.1    ODYU01002379    SOQ39797.1    ODYU01001513    SOQ37833.1    GDQN01009632    JAT81422.1    SOQ40332.1    KPI90987.1    SOQ39799.1    KPJ15684.1    ODYU01010616    SOQ55846.1    SOQ39798.1    ODYU01009947    SOQ54703.1    AGBW02010744    OWR47925.1    SOQ40333.1    AGBW02008493    OWR53226.1    OWR47924.1    JTDY01001984    KOB72401.1    KPI90985.1    KPJ15682.1    BABH01035041    OWR53227.1    AGBW02009869    OWR49694.1    AGBW02008353    OWR53602.1    KQ980824    KYN12579.1    BABH01018411    OWR49695.1    JTDY01003392    KOB69628.1    HACA01011369    CDW28730.1    GQ851941    ACX31149.1    GL434905    EFN74332.1    RSAL01000269    RVE43195.1    GU018007    ACY24341.1    LBMM01013914    KMQ85419.1    KQ981280    KYN43443.1    PZC74510.1    OWR49696.1    KQ434809    KZC06605.1    AGBW02014066    OWR42328.1    AGBW02010081    OWR49200.1    AY291325    AAQ24544.1    NWSH01000498    PCG76020.1    NWSH01000497    PCG76022.1    DQ489308    DQ489309    ABF39002.1    ABF39003.1    EAAA01002068    KPI90984.1    ODYU01013016    SOQ59625.1    KQ435756    KOX75917.1    RSAL01000014    RVE53228.1    KJ801816    AJO53282.1    KZ288328    PBC27937.1    KQ434827    KZC07503.1    ADMH02001954    ETN60289.1    NEVH01014358    PNF27884.1    PNF27885.1    PNF27882.1    PNF27883.1    KQ414658    KOC65663.1    GL762910    EFZ20472.1    KK107159    EZA56682.1    KZ150244    PZC71884.1    NNAY01001573    OXU23549.1    AFYH01236931    AFYH01236932    AFYH01236933    GAMC01007246    JAB99309.1    MRZV01002579    PIK33411.1    CP012524    ALC40778.1   
Pfam
PF00089   Trypsin        + More
PF00149   Metallophos
PF02872   5_nucleotid_C
PF16030   GD_N
PF00431   CUB
PF00057   Ldl_recept_a
PF15494   SRCR_2
Interpro
IPR018114   TRYPSIN_HIS        + More
IPR001314   Peptidase_S1A       
IPR009003   Peptidase_S1_PA       
IPR001254   Trypsin_dom       
IPR033116   TRYPSIN_SER       
IPR006146   5'-Nucleotdase_CS       
IPR036907   5'-Nucleotdase_C_sf       
IPR004843   Calcineurin-like_PHP_ApaH       
IPR008334   5'-Nucleotdase_C       
IPR029052   Metallo-depent_PP-like       
IPR006179   5_nucleotidase/apyrase       
IPR031986   GD_N       
IPR012224   Pept_S1A_FX       
IPR002172   LDrepeatLR_classA_rpt       
IPR000859   CUB_dom       
IPR036055   LDL_receptor-like_sf       
IPR035914   Sperma_CUB_dom_sf       
IPR023415   LDLR_class-A_CS       
IPR017448   SRCR-like_dom       
IPR001190   SRCR       
IPR036772   SRCR-like_dom_sf       
SUPFAM
SSF50494   SSF50494        + More
SSF55816   SSF55816       
SSF57424   SSF57424       
SSF49854   SSF49854       
SSF56487   SSF56487       
PDB
1EUF     E-value=5.28896e-10,     Score=148

Ontologies

Topology

Length:
147
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
1.20249
Exp number, first 60 AAs:
0.9648
Total prob of N-in:
0.29465
outside
1  -  147
 
 

Population Genetic Test Statistics

Pi
172.629805
Theta
132.329893
Tajima's D
0.91395
CLR
0
CSRT
0.630968451577421
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号