SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10701
Pre Gene Modal
BGIBMGA008244
Annotation
PREDICTED:_LOW_QUALITY_PROTEIN:_xanthine_dehydrogenase_1-like_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.009 Extracellular   Reliability : 1.397 Nuclear   Reliability : 1.294
 

Sequence

CDS
ATGTGTCGTGAGGCTGGGTGCGGAGCTTGCATTGTGTCTGTCGTCAAATGCCCAGGAGGACCGGTCGAAGCTGTTAATTCGTGTATGGTATCAATTACGTCATGTCAAGATTGGGAAATTACAACGATAGAAGAATTGGGGAACAGAAACAAAGGGTACAACGTTCTACAGAAGACTTTGGCTGATTATAATGGGACCCAATGTGGGTATTGCTCTCCAGCTTGGGTCATGGCGATGCACAGTCTCCTCAAAGGCAACAATGATTTAACGATGCTAGAAATAGAGAAATCCCTCAGCAGCAATGTCTGCAGATGTACTGGCTACAGACCCATATTGGACGCCTTCAAAAAATTTGCCAAAGACTGCCCTAAAGAGCATAGAATTTTAGACATAGAAGATTTGACTATCTGTAAGAGAACTGGTAAAAAATGTGATAAGAGTAATTGTAATGACGAAGACTGGTGCATAATTGAAAAAGAAGAATACAAGGCCGAGGGTATTATAGAAATACCGTTGCATGACAATAAATATTGGTACCGTGTTACGAATGTTGATGATATATTCAAAATTCTTAATCAGAAAGGATATGACTCATATATGCTGGTCTTTGGGAATACGGCTAAAGGTGCATATCCAATCTTCGAATATCCGAAAGTATTGATTGATATTAGCGCTGTAGCCCAATTAAAGATTTGCCTTTATGACCAGAATTTAGTAGTAGGTGTTGGATTGACGCTTACCGAATTATTGAATACTTTCGAGACAGCTTCAAAGGAAGAATACTTCAAGTACCTGAGGAAGCTTTACGAACATTTGTTATTGGTCGCCCACATACCCGTCAGAAATGTATGTAAATCGATACTAAGTTGTATGTTGTATCAAAAACGAAATCCATACAATAAGTAA
Protein
MCREAGCGACIVSVVKCPGGPVEAVNSCMVSITSCQDWEITTIEELGNRNKGYNVLQKTLADYNGTQCGYCSPAWVMAMHSLLKGNNDLTMLEIEKSLSSNVCRCTGYRPILDAFKKFAKDCPKEHRILDIEDLTICKRTGKKCDKSNCNDEDWCIIEKEEYKAEGIIEIPLHDNKYWYRVTNVDDIFKILNQKGYDSYMLVFGNTAKGAYPIFEYPKVLIDISAVAQLKICLYDQNLVVGVGLTLTELLNTFETASKEEYFKYLRKLYEHLLLVAHIPVRNVCKSILSCMLYQKRNPYNK

Summary

Cofactor
FAD
Mo-molybdopterin
[2Fe-2S] cluster
EMBL
BABH01034979    BABH01034980    BABH01034981    KZ150135    PZC72995.1    KQ460326    + More
KPJ15694.1    ODYU01005369    SOQ46133.1    RSAL01000123    RVE46648.1    PZC72996.1    JTDY01003022    KOB70290.1    NWSH01007964    PCG62737.1    PCG62735.1    PCG62736.1    LC017759    BAR64773.1    ODYU01000882    SOQ36316.1    KQ459606    KPI90999.1    ODYU01000376    SOQ35055.1    RSAL01000088    RVE48203.1    KPJ15692.1    KZ150165    PZC72656.1    NWSH01000648    PCG75033.1    KPI90997.1    AGBW02012116    OWR45615.1    ODYU01001481    SOQ37735.1    KPI90998.1    KPI91000.1    PCG75032.1    KPJ15693.1    RVE48202.1    KY595781    ARS46835.1    JTDY01003130    KOB70096.1    PZC72997.1    PZC72657.1    AGBW02008446    OWR53382.1    NWSH01007172    PCG63055.1    BABH01034958    BABH01034959    BABH01034960    BABH01034961    BABH01034962    BABH01034963    BABH01034964    BABH01034965    JTDY01003017    KOB70302.1    KY595780    ARS46834.1    ODYU01002030    SOQ39029.1    KQ459193    KPJ03063.1    JTDY01003126    KOB70107.1    KQ459674    KPJ20482.1    KQ461154    KPJ08620.1    AGBW02011403    OWR46707.1    NWSH01004179    PCG65395.1    ODYU01009314    SOQ53643.1    KP899546    AKQ06145.1    ODYU01004253    SOQ43930.1    ODYU01001472    SOQ37709.1    KPI90950.1    KF960796    AII21998.1    LC017754    BAR64768.1    GEYN01000003    JAV02126.1    AY947538    AAY22446.1    LC017757    BAR64771.1    RSAL01000295    RVE42846.1    ODYU01007852    SOQ50986.1    ODYU01001878    SOQ38698.1    GEYN01000001    JAV02128.1    NWSH01000022    PCG80663.1    KY595779    ARS46833.1    AGBW02008082    OWR54176.1    AGBW02009901    OWR49607.1    ODYU01002537    SOQ40155.1    KPI90909.1    KPI90901.1    KC952900    AGQ43599.1    KQ461196    KPJ06623.1    NWSH01000413    PCG76559.1    KY643683    AQY62686.1    LC017753    BAR64767.1    PCG76560.1    LC017752    BAR64766.1    ODYU01001109    SOQ36868.1    KP899547    AKQ06146.1    BABH01001678    BABH01001679    BABH01001657    BABH01001658    BABH01001659    BABH01001660    EU073423    ABW71271.1    KPJ06614.1    KF960794    AII21996.1    GECZ01010778    JAS58991.1    GBHO01014555    GBHO01014552    JAG29049.1    JAG29052.1    KY595778    ARS46832.1    KQ460556    KPJ13979.1    RSAL01000229    RVE43893.1    GEDC01004862    JAS32436.1    GDHC01015520    JAQ03109.1    GBHO01014557    GBHO01014554    GBRD01002756    JAG29047.1    JAG29050.1    JAG63065.1    GDHC01013650    GDHC01001960    JAQ04979.1    JAQ16669.1    KQ434912    KZC11368.1    UFQS01000745    UFQT01000745    SSX06553.1    SSX26900.1    ACPB03000354    ACPB03000355    BABH01001661    PCG76561.1    KF960795    AII21997.1    GECU01025650    JAS82056.1    EU073424    ABW71272.1    GBBI01004413    JAC14299.1    ADMH02001746    ETN61218.1   
Pfam
PF01315   Ald_Xan_dh_C        + More
PF03450   CO_deh_flav_C
PF02738   Ald_Xan_dh_C2
PF01799   Fer2_2
PF00941   FAD_binding_5
PF00111   Fer2
PF00271   Helicase_C
PF01130   CD36
Interpro
IPR002888   2Fe-2S-bd        + More
IPR016208   Ald_Oxase/xanthine_DH       
IPR000674   Ald_Oxase/Xan_DH_a/b       
IPR036318   FAD-bd_PCMH-like_sf       
IPR036884   2Fe-2S-bd_dom_sf       
IPR008274   AldOxase/xan_DH_Mopterin-bd       
IPR005107   CO_DH_flav_C       
IPR001041   2Fe-2S_ferredoxin-type       
IPR036010   2Fe-2S_ferredoxin-like_sf       
IPR036683   CO_DH_flav_C_dom_sf       
IPR006058   2Fe2S_fd_BS       
IPR016166   FAD-bd_PCMH       
IPR037165   AldOxase/xan_DH_Mopterin-bd_sf       
IPR002346   Mopterin_DH_FAD-bd       
IPR036856   Ald_Oxase/Xan_DH_a/b_sf       
IPR012675   Beta-grasp_dom_sf       
IPR016169   FAD-bd_PCMH_sub2       
IPR027417   P-loop_NTPase       
IPR002464   DNA/RNA_helicase_DEAH_CS       
IPR014001   Helicase_ATP-bd       
IPR001650   Helicase_C       
IPR002159   CD36_fam       
SUPFAM
SSF55447   SSF55447        + More
SSF56176   SSF56176       
SSF56003   SSF56003       
SSF47741   SSF47741       
SSF54665   SSF54665       
SSF54292   SSF54292       
SSF52540   SSF52540       
Gene 3D
PDB
4YTZ     E-value=1.05531e-21,     Score=254

Ontologies

Topology

Length:
301
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.20257
Exp number, first 60 AAs:
0.01287
Total prob of N-in:
0.08122
outside
1  -  301
 
 

Population Genetic Test Statistics

Pi
35.408983
Theta
53.474056
Tajima's D
0.019145
CLR
0.647227
CSRT
0.373531323433828
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号