SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10699
Pre Gene Modal
BGIBMGA008244
Annotation
PREDICTED:_LOW_QUALITY_PROTEIN:_xanthine_dehydrogenase_1-like_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.244 Mitochondrial   Reliability : 1.102
 

Sequence

CDS
ATGTCTGATACTCTTAAAAAAAACGCTGAGTATACCAAAAGGCGTGCCGCTGTCACGAAATTCAATGCTGAAAACAGATGGAAGAAACGTGGCCTTAGGTGCTCCTTCTCTAGGTGGACGCCAGCAGGAGGTCAGTACTTGGACACAAACATGGCAGTCTACCACGAAGATGGTACTGTTGCCATTTGCCACGGTGGCATAGAAATGGGCCAAGGGCTGAACACAAAAGCGGCCCAAATCTGTGCGTATTACTTAAAGATACCCTTAGAGAAAATTCAGGTTAAGGCCAACAGCACGGTTTTGACACCTAACGGCTTTATATCCGGTGGAAGTCAGACGTCACTGAATATAGGCGTAGCTGTTACGAGGTGTTGTGAGGAACTGTTACGAAGATTGCAGCCAATAAGATTGCAGATGAACAACCCGACTTGGGAGGAATTAGTGAAGAAAGCTTTTGATTCTAATGTCGATTTGCAAGTTCATGGTTTCGTTAGCGCTATCGATGCACAGATCTATAATATTTTCGGAGTTTCCTTGGCAGAAGTTGAGGTGGACGTTTTAACTGGAGAGTCGGAGATATTAAGAGTCGATATCCTACAAGACGTCGGGAAAAGCGTCAGCCCTGAAATCGATATCGGACAAGTTGAAGGGGCATTCATCATGGGTCTTGGGTACTGGACATGTGAGAAGTTGGTATATGAACCTAATACTGGGGAATTACTCACTGACCGCACTTGGAACTATAGCGTGCCCTTAGCAAGAGATATCCCGCAAGATCTCAGAGTATACTTCAGGAAGAACTCTTACAGTACTGAACTTTTTCTTGGAGCCAAAGGTACGCTTGTATTGCTATTGTCAAGAATGAATGAATGA
Protein
MSDTLKKNAEYTKRRAAVTKFNAENRWKKRGLRCSFSRWTPAGGQYLDTNMAVYHEDGTVAICHGGIEMGQGLNTKAAQICAYYLKIPLEKIQVKANSTVLTPNGFISGGSQTSLNIGVAVTRCCEELLRRLQPIRLQMNNPTWEELVKKAFDSNVDLQVHGFVSAIDAQIYNIFGVSLAEVEVDVLTGESEILRVDILQDVGKSVSPEIDIGQVEGAFIMGLGYWTCEKLVYEPNTGELLTDRTWNYSVPLARDIPQDLRVYFRKNSYSTELFLGAKGTLVLLLSRMNE

Summary

Cofactor
FAD
Mo-molybdopterin
[2Fe-2S] cluster
EMBL
BABH01034979    BABH01034980    BABH01034981    KZ150165    PZC72655.1    KQ459606    + More
KPI91000.1    ODYU01003306    SOQ41884.1    PZC72656.1    KQ460326    KPJ15694.1    NWSH01000648    PCG75033.1    PCG75032.1    LC017758    BAR64772.1    RSAL01000123    RVE46648.1    PZC72657.1    KPI90998.1    KY595781    ARS46835.1    LC017756    BAR64770.1    JTDY01003130    KOB70096.1    KPJ15693.1    KZ150135    PZC72994.1    ODYU01002094    SOQ39169.1    ODYU01000882    SOQ36316.1    KPI90999.1    NWSH01007964    PCG62736.1    PZC72996.1    JTDY01003126    KOB70107.1    ODYU01001481    SOQ37735.1    KPI90997.1    KPJ15692.1    RSAL01000088    RVE48202.1    PCG62735.1    AGBW02008446    OWR53382.1    PZC72997.1    ODYU01000376    SOQ35055.1    RVE48204.1    JTDY01003022    KOB70290.1    PCG62737.1    BABH01034958    BABH01034959    BABH01034960    BABH01034961    BABH01034962    BABH01034963    BABH01034964    BABH01034965    KY595780    ARS46834.1    AGBW02011403    OWR46707.1    GEDC01003026    JAS34272.1    LC017757    BAR64771.1    KQ459193    KPJ03064.1    ODYU01000094    SOQ34283.1    ODYU01004588    SOQ44620.1    KQ459674    KPJ20482.1    LC017755    BAR64769.1    BABH01001558    NWSH01007172    PCG63055.1    NEVH01020852    PNF21138.1    JTDY01003017    KOB70302.1    ODYU01002537    SOQ40155.1    ODYU01000095    SOQ34285.1    ODYU01001878    SOQ38698.1    KF960794    AII21996.1    ODYU01004253    SOQ43930.1    NWSH01000413    PCG76559.1    NWSH01002143    PCG69059.1    BABH01001661    GEDC01028540    JAS08758.1    BABH01001657    BABH01001658    BABH01001659    BABH01001660    GECU01024721    JAS82985.1    GEDC01019096    JAS18202.1    PCG76560.1    EU073424    ABW71272.1    ODYU01001109    SOQ36868.1    KF960795    AII21997.1    BABH01001568    BABH01001569    BABH01001570    BABH01001571    BABH01001572    BABH01001573    KK852750    KDR17215.1    PCG76561.1    KPJ03063.1    KPI90950.1    AXCM01000856    GGFL01002475    MBW66653.1    LC017752    BAR64766.1    ADMH02001746    ETN61219.1    AXCN02000553    AGBW02009901    OWR49607.1    KQ461154    KPJ08620.1    PCG76558.1    GFDF01002904    JAV11180.1    GECL01002669    JAP03455.1    GECZ01022332    JAS47437.1    GECU01009219    JAS98487.1    KPI90909.1    GFDF01002843    JAV11241.1    RSAL01000229    RVE43893.1    KQ982557    KYQ55015.1    GFDF01002797    JAV11287.1    GBHO01015297    JAG28307.1    KQ979701    KYN19698.1    GECU01011660    JAS96046.1    GGFJ01001064    MBW50205.1    GGFJ01001065    MBW50206.1    AXCN02000554   
Pfam
PF01315   Ald_Xan_dh_C        + More
PF03450   CO_deh_flav_C
PF02738   Ald_Xan_dh_C2
PF01799   Fer2_2
PF00941   FAD_binding_5
PF00111   Fer2
PF01130   CD36
Interpro
IPR002888   2Fe-2S-bd        + More
IPR016208   Ald_Oxase/xanthine_DH       
IPR000674   Ald_Oxase/Xan_DH_a/b       
IPR036318   FAD-bd_PCMH-like_sf       
IPR036884   2Fe-2S-bd_dom_sf       
IPR008274   AldOxase/xan_DH_Mopterin-bd       
IPR005107   CO_DH_flav_C       
IPR001041   2Fe-2S_ferredoxin-type       
IPR036010   2Fe-2S_ferredoxin-like_sf       
IPR036683   CO_DH_flav_C_dom_sf       
IPR006058   2Fe2S_fd_BS       
IPR016166   FAD-bd_PCMH       
IPR037165   AldOxase/xan_DH_Mopterin-bd_sf       
IPR002346   Mopterin_DH_FAD-bd       
IPR036856   Ald_Oxase/Xan_DH_a/b_sf       
IPR016169   FAD-bd_PCMH_sub2       
IPR012675   Beta-grasp_dom_sf       
IPR002159   CD36_fam       
SUPFAM
SSF55447   SSF55447        + More
SSF56176   SSF56176       
SSF56003   SSF56003       
SSF47741   SSF47741       
SSF54665   SSF54665       
SSF54292   SSF54292       
Gene 3D
PDB
6Q6Q     E-value=4.8363e-50,     Score=498

Ontologies

Topology

Length:
290
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.231
Exp number, first 60 AAs:
0.00057
Total prob of N-in:
0.08474
outside
1  -  290
 
 

Population Genetic Test Statistics

Pi
267.382898
Theta
208.71386
Tajima's D
0.878987
CLR
0.021667
CSRT
0.632818359082046
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号