SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10692  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA008268
Annotation
PREDICTED:_xanthine_dehydrogenase_2-like_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.001 Extracellular   Reliability : 1.199 Nuclear   Reliability : 1.553
 

Sequence

CDS
ATGTGTCGTCAGGCCGGTTGCGGTGCTTGCATAGTGGCAGCTAAACGTCCGGACCGTCGTACGAATGAAGCTGTCAATTCGTGCATGGTCCCGATAACATCCTGTCAAAATTGGGAAATAACAACCATAGAAGGAGTGGGAAATAGGAATAAAGGATACCACCCTTTACAAAAAAGTCTAGCAGCTAACAACGGTAGCCAGTGTGGTTACTGTTCGCCGGGATGGGTTATGTCTATGTACAGCCTTTTGCAGCAATACAAAGCCCCAAGAATGATAGAAATCGAAAAACTACTAGGGTCTAACGTCTGCAGATGTACTGGGTACAGACCAATTTTAGATGCCTTCAAATCTTTCGCTAAAGATGCTCCGAAAAATCTAATTTCTGATATTGAAGACTTAGTCATTTGTAAGAAGACCGGACAGCCTTGCGATAATCCATGCGATGAAGAAGATTGGTGCTTGGTGAATAAAGAGGACGCTGATGAGCCGAACACGATTAGGATAGAATTGTGTGACGGAAGACTTTTTTTTAAGGTTTTTAAAATAAGTGAAATTCTGCGACTATTGGTAACGGAGAATTATGATTCTTACCAACTTGTTTGGGGAAATACGGCTAGAGGTGCATATCCAACAGATGTGCGCGCCCAGCTATTAATAGATATAACGGGGGTAAATGAATTAAAGGGATATTACTTGGATCAGAATCTGGTCATCAATGCTGGAACAACCTTGACTGAATTGATGAATATCTATAAAAAACTGTCAGAAAAAGAAGAGGACTTTCAATATTTAGACCGGTTTTATGAGCATTTGGAAATGGTAGCTCATGTTGCTGTCAGAAATTATTAG
Protein
MCRQAGCGACIVAAKRPDRRTNEAVNSCMVPITSCQNWEITTIEGVGNRNKGYHPLQKSLAANNGSQCGYCSPGWVMSMYSLLQQYKAPRMIEIEKLLGSNVCRCTGYRPILDAFKSFAKDAPKNLISDIEDLVICKKTGQPCDNPCDEEDWCLVNKEDADEPNTIRIELCDGRLFFKVFKISEILRLLVTENYDSYQLVWGNTARGAYPTDVRAQLLIDITGVNELKGYYLDQNLVINAGTTLTELMNIYKKLSEKEEDFQYLDRFYEHLEMVAHVAVRNY

Summary

Cofactor
FAD
Mo-molybdopterin
[2Fe-2S] cluster
EMBL
BABH01034958    BABH01034959    BABH01034960    BABH01034961    BABH01034962    BABH01034963    + More
BABH01034964    BABH01034965    KZ150135    PZC72995.1    RSAL01000088    RVE48203.1    ODYU01005369    SOQ46133.1    ODYU01000882    SOQ36316.1    KQ460326    KPJ15692.1    RSAL01000123    RVE46648.1    NWSH01007964    PCG62735.1    PZC72996.1    PCG62737.1    PCG62736.1    BABH01034979    BABH01034980    BABH01034981    KPJ15694.1    NWSH01000648    PCG75032.1    KQ459606    KPI90998.1    LC017759    BAR64773.1    KPI90997.1    KPJ15693.1    KZ150165    PZC72657.1    ODYU01000376    SOQ35055.1    ODYU01001481    SOQ37735.1    NWSH01007172    PCG63055.1    PZC72656.1    KPI90999.1    KQ459193    KPJ03063.1    PCG75033.1    KQ459674    KPJ20482.1    AGBW02008446    OWR53382.1    PZC72997.1    ODYU01002030    SOQ39029.1    KY595781    ARS46835.1    KQ461154    KPJ08620.1    KPI91000.1    KY595780    ARS46834.1    JTDY01003017    KOB70302.1    JTDY01003130    KOB70096.1    AGBW02012116    OWR45615.1    NWSH01004179    PCG65395.1    JTDY01003022    KOB70290.1    RVE48202.1    AGBW02011403    OWR46707.1    LC017757    BAR64771.1    ODYU01001472    SOQ37709.1    LC017752    BAR64766.1    KP899546    AKQ06145.1    RSAL01000295    RVE42846.1    NWSH01000413    PCG76559.1    KPI90950.1    PCG76560.1    ODYU01004253    SOQ43930.1    ODYU01002537    SOQ40155.1    GEYN01000001    JAV02128.1    EU073423    ABW71271.1    BABH01001657    BABH01001658    BABH01001659    BABH01001660    LC017753    BAR64767.1    KPI90909.1    AY947538    AAY22446.1    AGBW02008082    OWR54176.1    AGBW02009901    OWR49607.1    LC017754    BAR64768.1    ODYU01001109    SOQ36868.1    GEYN01000003    JAV02126.1    KY595779    ARS46833.1    KQ461196    KPJ06623.1    KPI90901.1    PCG76561.1    KP899547    AKQ06146.1    BABH01001661    KY595778    ARS46832.1    RSAL01000229    RVE43893.1    KPJ06614.1    GANO01002236    JAB57635.1    KF960794    AII21996.1    UFQS01000745    UFQT01000745    SSX06553.1    SSX26900.1    ODYU01001878    SOQ38698.1    EU073424    ABW71272.1    ODYU01009314    SOQ53643.1    GEDC01004862    JAS32436.1    CH477659    EJY57867.1    GBHO01014555    GBHO01014552    JAG29049.1    JAG29052.1    KQ460556    KPJ13979.1    ODYU01007852    SOQ50986.1    KQ414670    KOC64413.1    CVRI01000075    CRL08599.1    GBHO01014557    GBHO01014554    GBRD01002756    JAG29047.1    JAG29050.1    JAG63065.1    GDHC01013650    GDHC01001960    JAQ04979.1    JAQ16669.1    GDHC01015520    JAQ03109.1    KC952900    AGQ43599.1    GBBI01004413    JAC14299.1    ATLV01024093    KE525349    KFB50588.1    JTDY01003126    KOB70107.1    BABH01001678    BABH01001679    GFDL01008214    JAV26831.1    JXUM01002771    KQ560144    KXJ84188.1    AXCN02000553    KY643683    AQY62686.1    KK855082    PTY20711.1    DS232324    EDS40041.1    GFDF01002872    JAV11212.1    JXUM01061540    KQ562154    KXJ76553.1   
Pfam
PF02738   Ald_Xan_dh_C2        + More
PF01315   Ald_Xan_dh_C
PF03450   CO_deh_flav_C
PF00111   Fer2
PF00941   FAD_binding_5
PF01799   Fer2_2
PF00271   Helicase_C
PF01130   CD36
Interpro
IPR000674   Ald_Oxase/Xan_DH_a/b        + More
IPR002888   2Fe-2S-bd       
IPR036884   2Fe-2S-bd_dom_sf       
IPR005107   CO_DH_flav_C       
IPR008274   AldOxase/xan_DH_Mopterin-bd       
IPR036318   FAD-bd_PCMH-like_sf       
IPR001041   2Fe-2S_ferredoxin-type       
IPR036010   2Fe-2S_ferredoxin-like_sf       
IPR036683   CO_DH_flav_C_dom_sf       
IPR036856   Ald_Oxase/Xan_DH_a/b_sf       
IPR006058   2Fe2S_fd_BS       
IPR016166   FAD-bd_PCMH       
IPR002346   Mopterin_DH_FAD-bd       
IPR037165   AldOxase/xan_DH_Mopterin-bd_sf       
IPR016208   Ald_Oxase/xanthine_DH       
IPR012675   Beta-grasp_dom_sf       
IPR016169   FAD-bd_PCMH_sub2       
IPR027417   P-loop_NTPase       
IPR002464   DNA/RNA_helicase_DEAH_CS       
IPR014001   Helicase_ATP-bd       
IPR001650   Helicase_C       
IPR002159   CD36_fam       
SUPFAM
SSF54665   SSF54665        + More
SSF54292   SSF54292       
SSF55447   SSF55447       
SSF56176   SSF56176       
SSF56003   SSF56003       
SSF47741   SSF47741       
SSF52540   SSF52540       
Gene 3D
PDB
4YTZ     E-value=2.68355e-28,     Score=310

Ontologies

Topology

Length:
282
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0492000000000001
Exp number, first 60 AAs:
0.00469
Total prob of N-in:
0.10668
outside
1  -  282
 
 

Population Genetic Test Statistics

Pi
230.179802
Theta
145.569451
Tajima's D
2.26049
CLR
0.000645
CSRT
0.91960401979901
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号