SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10690  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA008268
Annotation
PREDICTED:_LOW_QUALITY_PROTEIN:_xanthine_dehydrogenase_1-like_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.219 PlasmaMembrane   Reliability : 1.65
 

Sequence

CDS
ATGTCTAATATTGAGTTTACAGTCAATGGGATCTTGTGTTCAGTGGGATGCGAAGTCTCCTCAACTTTGATGCTGGTGGACTACATCCGGCATCATTTGGAGCTGCGCGGCACCAAGTACATGTGTCGTGAGGCTGGATGTGGGGCCTGCAACGTCTCTGTGATTAAGACACCGGGTGGTCCAGAATTATCAGTGAATTCGTGCGTGGTTCCAGTAGCTTCCTGCGATGGATGGAAAATTAAGACGATCGAAAGTATCGGCAACAAGAAGGATGGCTACCATTCCATCCAGAAGGCTGTGGCCAAATGTAACGGCACCCAGTGTGGGTACTGCACTCCGGGATGGGTGATGGCTATGTACAGTTTGTTACAGAACAACACCGAAATGACCATGCTGGAGATAGAAAAGTCGTTTGGTGGCAACATCTGTAGGTGCACCGGCTATAGGACCATCCTTCAGGCTTTCAAGCAATACGCAAAAGACTCCCCCACTTCGATCAGCGACATTGAAGATTTGCATATCTGCGAGAAATCCGATCAGCAATGTTGCAAGAAAAACTGCGACGAAAGCGACTGGTGCCTGGTCGCCAATAACGTCGGGTCGACCACCAAGGAATTAACATTAAAGGACGGCGTTAAATGGTTCACCGTTACCCAAATCTCTGATATTTTCGAGATTTTACTGGTCGAAGGCACTGACTCTTATATGTTAGCGGCTGGGAACACTTCTAAAGTACCATATCCAATAACGACTCCTTTTAGTGTAATAATCGATATATCTGGAGTCTCAGAATTAAAAGGATACACTTTGGACCAGAACCTTGTGGTTGGAGCTGGAAATACTCTCACCGAGTTCATGGAAATTCTAGAAAAGGCCTCTACTGAGGAGGGATTTGAATATTTAGTAAAATTTACTGAGCATATGGAGTATCTTGGCCATAAGACACTAAGGAATATTGCAACCATTGGAGGTAACCTGATGATGAAAAATAAAAACGTTGCTTTCGCTTCAGATCTGTATCTGTTATTCGAAATTGTTGGAGCACAAGTTACAGTCAAGAGTCAAGAGTACGGAACCGAAACAGTGACGATGCACGAGTTCACCCTCTTAAAAATGGTTGGAAAAGTCTTAGTGAATATATTACTACCGCCCCTATCTGAAGATTACAAAATTGTGACTTTTAAGATCATGCAACGTGCCCAGGCCGTCCACGCCACTTTGAATGCCGGATTTAATTACAAACTAAGCAACGACAATGTGGTTAGAGAAGCTAAAATCGTTTACGGTGCTTTGACGACCGCTTCGACCAGGGCTACAGAAACTGAAAAATATTTGATTGGCAAACCACTCTTCACCAACGAAACTCTGCAAGGAGCTCTCACAGTTTTGGATAGTGATCTGGTCGTAGTTGAAAATCCTCCAGAACCATCCGCAGAGTACAGAAAGCATTTGGCTCTATGTCTGTTTTATAAGGGTCTACTTTCCCTTTGCCCCACAGCAACTCTCCAGCCTCGATACCGATCAGGAGCCATAAAAATCCACGACTCTCGTCCGGTCTCGGAAGCCACACAGACATATGAGACCAACAATAAGCTGTATCCTCTGACGGAACCGCTACCGAAACACGAAGCTTTGATCCAATGTTCCGGCGAAGCCATGTATTCCGATGACTTGCCGAGTTTGCCTCACGAGGTGTTTGCTTCGTTCGTCCTTAGTACGGTGGCTGTCGGAGAAATCATTTCCATTGATCCGACTAAAGCACTGGAAGTTGATGGTGTCATAGCATTTTATTCAGCGAAAGACATTCCTGGGCTAAACTCGTTCACTCCTGATGATCTACCGTTATACGCCCAAGCGGAAGAAGTACTATGCAGCGGTCGGGTCTGTTACTACGAACAACCAATCGGCATCATTGTGGCTGAAGACCAAATAACAGCCGACATAGCTGCCAAACTGGTCAAAGCCACATACAAAAATTTCAAGAACCCAGTCGTCAACATTAAAGAAGCCATTCAAGATGCTTCAAGGAACACTTTGTATACTTCTGCTGATGCCACGGAAACAGGCACGGACGTCACCAAAGTTATTAGTGGCACTAATTCTGGAGACGGTCAATACCATTTCACGATGGAGACTTTGGTCTGTGTGACTAACCCCACTGAAGAGGGCTTGGAAATTCACACAGCTACACAGTGGACCAACGGAGTTCAACTAATGGTTTCTCGTGCTTTGGGCATTGAGAAAAACAGAGTGGATGTCCACGTGCGCCGTGTTGGTGGAGCTTACGGGTTGAAAATATCCCGCAGCACACAAGTGGCAGTAGCGTGCAGCCTGGTGACATATAAACTGAACAGACCGTGCCGCATCCTGCAGTCCTTGGCCACAAATATGAAAGCAATGGGCAAAAGGTTACCGTACCTTGCTAAATATGAGGTAGCCGTTAACAGTTCCGGTACAGTACAATACACGAACTTAAATATGTACGAAGATAATGGATACAAGATAAATGAAGATTTCTACGGCCTTAGTCTTGATGCTATAAACAATTGCTACAAATCTAAAAACTTAACCTATAAATGTTACAATACCGTTACCGACACCCACAAGAATACTTGGTGCAGAGCTCCCGGTACAATGGAATTTATAGCCAACACCGAGCTAATTATGGAGCGCATAGCTTATGAGCTTGAACTGGACCCGGTCACCGTACGTCTTGCAAACGTCGATACAAAACGTTATAAAGAGGTCATAGAAGCTTACGAAACATTGAAAACGAAAGCTGATTATGAAGCAAGGCGTGCGGAAGTCAATACTTTTAATGCCACCAATAGATGGAGGAAACGTGGACTAAGATTCAGCTTCCTACGGTGGACTCCCATCAGCGCTGGTATAACCGGAGCAACCGTATCCATCAATCAAGGCGATGCAACCGTAACCATAGTCCATGGTGGTGTCGAAATGGGGCAAGGTATAAACACTAAAGCCATGCAAATTTGCGCTCATTTGCTCAAAATTTCCATGGATAAAATCCAAGTCAAAGCAACTAATACGATAGCTTTCACAAACCAGTTTGTTACCGGAGGTAGTGTTGCATCAGAAAACGTTAGTGCTGCTGTCGGTGCAGCTTGTGAAACACTTTTAAGTAGACTGGAAGCGGTCAAGGCTACTATGGAAGGTAGTCCAACTTTCGAGCAGGTAGTCAAGCAAGCGTTCGACACTAATGTTGATTTGAAAGCTGACGGATTACGCAGTGCCTCTAATTTTGAGCCTTATGATGTTTTTGGAGCTACATTAGCAGAGGTAGAAATTGACGTGTTGACTGGAGAACATGAAATCCTTCGAGTTGATCTTATCGAGGATGTAGGAACTTCAGTAAACCCTGAAATCGATATTGGACAAATCGAAGGTGCTTTCGTCATGGGTTTGGGTTATTGGACCTGTGAACAATTGGTCTACAACTCCACTTCTGGCCAACTCCTCACTACAAGGGCTTGGAACTATTTCGTACCTCAGGCGAGAGATATTCCGCAGAAGATGAACATACACCTCAGACCTAAATCTTACAGTAACGATACGGCTTTTGGTTCTAAATGTGTTGGGGAACCACCACTGTGCATGTCAATTGCATTAGTACTCGCCATAATAGAGGCAACAGCTGCGGCCAGAAAGGAATCCGGATACGGCGCAACCGACATCTTCAATATCGGTGCCCCGTTCACCCCGGAGAAAATCTCTCTTTCAACAAAAACCGCCATTAAAGAACTACTGTACAACTAA
Protein
MSNIEFTVNGILCSVGCEVSSTLMLVDYIRHHLELRGTKYMCREAGCGACNVSVIKTPGGPELSVNSCVVPVASCDGWKIKTIESIGNKKDGYHSIQKAVAKCNGTQCGYCTPGWVMAMYSLLQNNTEMTMLEIEKSFGGNICRCTGYRTILQAFKQYAKDSPTSISDIEDLHICEKSDQQCCKKNCDESDWCLVANNVGSTTKELTLKDGVKWFTVTQISDIFEILLVEGTDSYMLAAGNTSKVPYPITTPFSVIIDISGVSELKGYTLDQNLVVGAGNTLTEFMEILEKASTEEGFEYLVKFTEHMEYLGHKTLRNIATIGGNLMMKNKNVAFASDLYLLFEIVGAQVTVKSQEYGTETVTMHEFTLLKMVGKVLVNILLPPLSEDYKIVTFKIMQRAQAVHATLNAGFNYKLSNDNVVREAKIVYGALTTASTRATETEKYLIGKPLFTNETLQGALTVLDSDLVVVENPPEPSAEYRKHLALCLFYKGLLSLCPTATLQPRYRSGAIKIHDSRPVSEATQTYETNNKLYPLTEPLPKHEALIQCSGEAMYSDDLPSLPHEVFASFVLSTVAVGEIISIDPTKALEVDGVIAFYSAKDIPGLNSFTPDDLPLYAQAEEVLCSGRVCYYEQPIGIIVAEDQITADIAAKLVKATYKNFKNPVVNIKEAIQDASRNTLYTSADATETGTDVTKVISGTNSGDGQYHFTMETLVCVTNPTEEGLEIHTATQWTNGVQLMVSRALGIEKNRVDVHVRRVGGAYGLKISRSTQVAVACSLVTYKLNRPCRILQSLATNMKAMGKRLPYLAKYEVAVNSSGTVQYTNLNMYEDNGYKINEDFYGLSLDAINNCYKSKNLTYKCYNTVTDTHKNTWCRAPGTMEFIANTELIMERIAYELELDPVTVRLANVDTKRYKEVIEAYETLKTKADYEARRAEVNTFNATNRWRKRGLRFSFLRWTPISAGITGATVSINQGDATVTIVHGGVEMGQGINTKAMQICAHLLKISMDKIQVKATNTIAFTNQFVTGGSVASENVSAAVGAACETLLSRLEAVKATMEGSPTFEQVVKQAFDTNVDLKADGLRSASNFEPYDVFGATLAEVEIDVLTGEHEILRVDLIEDVGTSVNPEIDIGQIEGAFVMGLGYWTCEQLVYNSTSGQLLTTRAWNYFVPQARDIPQKMNIHLRPKSYSNDTAFGSKCVGEPPLCMSIALVLAIIEATAAARKESGYGATDIFNIGAPFTPEKISLSTKTAIKELLYN

Summary

Cofactor
FAD
Mo-molybdopterin
[2Fe-2S] cluster
EMBL
BABH01034958    BABH01034959    BABH01034960    BABH01034961    BABH01034962    BABH01034963    + More
BABH01034964    BABH01034965    RSAL01000123    RVE46648.1    NWSH01000648    PCG75033.1    NWSH01007964    PCG62737.1    KZ150135    PZC72996.1    PCG75032.1    ODYU01001481    SOQ37735.1    PCG62736.1    KY595781    ARS46835.1    KQ460326    KPJ15694.1    KQ459606    KPI90999.1    KPI90997.1    BABH01034979    BABH01034980    BABH01034981    ODYU01000376    SOQ35055.1    PCG62735.1    KPI91000.1    PZC72997.1    ODYU01000882    SOQ36316.1    KPI90998.1    KPJ15693.1    RSAL01000088    RVE48202.1    KZ150165    PZC72655.1    AGBW02011403    OWR46707.1    JTDY01003126    KOB70107.1    JTDY01003022    KOB70290.1    ODYU01003306    SOQ41884.1    KY595780    ARS46834.1    PZC72656.1    KQ459674    KPJ20482.1    NWSH01007172    PCG63055.1    KQ459193    KPJ03063.1    ODYU01002094    SOQ39169.1    NWSH01000413    PCG76559.1    BABH01001558    KF960794    AII21996.1    LC017753    BAR64767.1    LC017757    BAR64771.1    KP899546    AKQ06145.1    RSAL01000229    RVE43893.1    ODYU01002537    SOQ40155.1    KY595779    ARS46833.1    AGBW02008082    OWR54176.1    KQ461154    KPJ08620.1    BABH01001657    BABH01001658    BABH01001659    BABH01001660    ODYU01004253    SOQ43930.1    KF960795    AII21997.1    PCG76561.1    EU073423    ABW71271.1    KPI90950.1    KY643683    AQY62686.1    PCG76558.1    ODYU01001109    SOQ36868.1    GBBI01004413    JAC14299.1    ODYU01001878    SOQ38698.1    LC017752    BAR64766.1    EU073424    ABW71272.1    LC017754    BAR64768.1    KF960796    AII21998.1    GEYN01000003    JAV02126.1    KY595778    ARS46832.1    KQ434912    KZC11368.1    GEYN01000002    JAV02127.1    GEDC01004862    JAS32436.1    AGBW02010767    OWR47879.1    NWSH01000022    PCG80663.1    KQ979701    KYN19698.1    KQ982557    KYQ55015.1    UFQS01000745    UFQT01000745    SSX06553.1    SSX26900.1    KQ414670    KOC64413.1    GGFL01002295    MBW66473.1    ACPB03021369    ACPB03021370    ODYU01007852    SOQ50986.1    KQ435826    KOX72014.1    ADMH02001746    ETN61221.1    AXCN02000553    BABH01001568    BABH01001569    BABH01001570    BABH01001571    BABH01001572    BABH01001573    KC952900    AGQ43599.1    KQ461196    KPJ06614.1    GFDF01002797    JAV11287.1    KP899547    AKQ06146.1    DS497731    EFA13013.1    GECU01009219    JAS98487.1    KQ769812    OAD52839.1    AXCN02000554    KQ971466    EFA13012.2    APCN01000032    GGFJ01000687    MBW49828.1    GGFJ01000686    MBW49827.1    DS232324    EDS40039.1    GFDL01004496    JAV30549.1    CVRI01000075    CRL08602.1   
Pfam
PF02738   Ald_Xan_dh_C2        + More
PF01315   Ald_Xan_dh_C
PF03450   CO_deh_flav_C
PF00111   Fer2
PF00941   FAD_binding_5
PF01799   Fer2_2
PF01130   CD36
PF07651   ANTH
Interpro
IPR000674   Ald_Oxase/Xan_DH_a/b        + More
IPR002888   2Fe-2S-bd       
IPR036884   2Fe-2S-bd_dom_sf       
IPR005107   CO_DH_flav_C       
IPR008274   AldOxase/xan_DH_Mopterin-bd       
IPR036318   FAD-bd_PCMH-like_sf       
IPR001041   2Fe-2S_ferredoxin-type       
IPR036010   2Fe-2S_ferredoxin-like_sf       
IPR036683   CO_DH_flav_C_dom_sf       
IPR036856   Ald_Oxase/Xan_DH_a/b_sf       
IPR006058   2Fe2S_fd_BS       
IPR016166   FAD-bd_PCMH       
IPR002346   Mopterin_DH_FAD-bd       
IPR037165   AldOxase/xan_DH_Mopterin-bd_sf       
IPR016208   Ald_Oxase/xanthine_DH       
IPR012675   Beta-grasp_dom_sf       
IPR016169   FAD-bd_PCMH_sub2       
IPR002159   CD36_fam       
IPR013809   ENTH       
IPR008942   ENTH_VHS       
IPR011417   ANTH_dom       
IPR014712   Clathrin_AP_dom2       
IPR006621   Nose-resist-to-fluoxetine_N       
SUPFAM
SSF54665   SSF54665        + More
SSF54292   SSF54292       
SSF55447   SSF55447       
SSF56176   SSF56176       
SSF56003   SSF56003       
SSF47741   SSF47741       
SSF48464   SSF48464       
PDB
4UHX     E-value=3.68477e-145,     Score=1325

Ontologies

Topology

Length:
1258
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
1.55557
Exp number, first 60 AAs:
1.44686
Total prob of N-in:
0.06604
outside
1  -  1258
 
 

Population Genetic Test Statistics

Pi
221.784576
Theta
187.638466
Tajima's D
0.51643
CLR
0.155885
CSRT
0.51822408879556
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
24093152 TPEAADAPK 95.65 8e-11
27102218 AWNYFVPQAR 95.65 8e-11
24093152 VCYCQGGEVVCR 100.00 8e-10
27102218 RVGGAYGIK 100.00 8e-10
27102218 TGEIITDTSWTYYVPQAR 100.00 1e-08
27102218 KESGYGATDIFNIGAPFTPEK 100.00 5e-08
28467696 ESGYESDSTIIFR 100.00 5e-08
24093152 IHAGDDAVGVR 100.00 2e-06
27102218 NPVVNIK 100.00 2e-06
24093152 ATIPIIK 100.00 0.013
27102218 IANVDTKR 100.00 0.013
24093152 PVIDIQSCEISSPETTFDR 100.00 0.019
27102218 YIIGKPIFTNETIQGAITVIDSDIVVVENPPEPSAEYRK 100.00 0.019
24093152 EAFIAVPCK 100.00 0.029
27102218 IIQSIATNMK 100.00 0.029
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号