SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10647  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA014429
Annotation
serine_protease_[Bombyx_mandarina]
Location in the cell
Extracellular   Reliability : 2.753
 

Sequence

CDS
ATGAAGGTCTTCGCAGCAGTACTGATGGCGTTGGCGGCCGTGGTCGTGGCAGAAGAGGCCATCGAACTTGACTACCACAACAAGATCGGTATCCCCCGGGCTGAGAGTCTTAGACGCGCCGAGGAAGCCGCTGACTTCGACGGTACCAGGATTGTGGGTGGTTCTGCCGCCAACGCTGGTGCTCACCCCCATCTTGCTGGACTTGTGATCGCACTCACGAATGGCAGAACTTCCATCTGCGGAGCTTCCTTACTGACCAACACCCGCTCCGTGACCGCGGCTCACTGCTGGAGAACCAGGAACGCCCAGGCTCGTCAGTTCACCCTCGCTTTTGGTACAGCTAACATCTTCTCCGGCGGCACCAGGGTCACCACCTCCAGTGTCCACCTGCACGGCAGCTACAACATGAACAACCTCAACAACGACGTCGCCATCATCAACCACAACCATGTTGGCTTCAACAACAACATCCAGCGCATCAACCTAGCCAGTGGAAACAACAACTTTGCTGGTACTTGGGCCTGGGCTGCCGGCTTCGGGAGGACCTCCGATGCTGCTTCGGGAGCCAACAACCAACAAAAACGCCAAGTGAGCCTCCAGGTCATCACCAACGCCGTCTGCGCCCGCACGTACGGAAACTCTGTGATCATTGGCTCCACCCTCTGTGTTTCCGGCGCTAACGGTCGCAGCACCTGCAGCGGAGACTCCGGCGGCCCTCTCTCCATCGGCAGCGGCGGAGGCCGTCAGCTGATCGGTATCACGTCGTTCGGATCAGACAGAGGCTGCCAGAGAGGCTACCCTGCCGGCTTCGCTAGAGTCACATCTTTCAACTCCTGGATCCGGGCTAGAATTTAA
Protein
MKVFAAVLMALAAVVVAEEAIELDYHNKIGIPRAESLRRAEEAADFDGTRIVGGSAANAGAHPHLAGLVIALTNGRTSICGASLLTNTRSVTAAHCWRTRNAQARQFTLAFGTANIFSGGTRVTTSSVHLHGSYNMNNLNNDVAIINHNHVGFNNNIQRINLASGNNNFAGTWAWAAGFGRTSDAASGANNQQKRQVSLQVITNAVCARTYGNSVIIGSTLCVSGANGRSTCSGDSGGPLSIGSGGGRQLIGITSFGSDRGCQRGYPAGFARVTSFNSWIRARI

Summary

Similarity
Belongs to the peptidase S1 family.
Belongs to the ETS family.
EMBL
BABH01041853    AY945210    EU338400    AAX39408.1    ABY58153.1    AB117641    + More
BAD13342.1    BABH01041861    BABH01041859    BABH01041860    AY945211    DQ310733    AAX39409.1    ABC26003.1    BABH01041852    BABH01042790    AB003670    BAA20136.1    KQ459472    KPJ00237.1    KQ459586    KPI97880.1    BABH01041868    RSAL01000073    RVE48982.1    KQ458725    KPJ05397.1    KF039687    AGU27161.1    KQ460401    KPJ14971.1    KQ459581    KPI99177.1    KQ458978    KPJ04519.1    KQ461033    KPJ09997.1    KZ150191    PZC72392.1    KQ460140    KPJ17495.1    KPJ05400.1    ODYU01007826    SOQ50918.1    KM083780    AIR09761.1    KQ460845    KPJ12032.1    KPJ05401.1    AGBW02011570    OWR46476.1    NWSH01001385    PCG71452.1    AY953056    AY953057    AAX62029.1    AAX62030.1    FJ205420    ACR15987.3    KR024679    ALE15221.1    KPJ17496.1    JQ904141    AFM77771.1    KR024680    ALE15222.1    JQ904140    AFM77770.1    KPJ05396.1    BABH01027594    KQ459620    KPJ20544.1    KPJ17494.1    GDQN01000181    JAT90873.1    EU672968    ACD44927.1    BABH01023267    AF233732    AAF71519.1    KQ459388    KPJ01122.1    KQ459185    KPJ03332.1    KM360186    AKH49602.1    Y12287    CAA72966.1    HM990173    ADT80821.1    Y12281    CAA72960.1    NWSH01000291    PCG77692.1    FJ205413    ACR15981.1    Y12280    CAA72959.1    AY618891    AAV33654.1    FJ205404    ACR15972.2    AF233731    AF233734    AAF71518.1    AAF71716.1    KT907053    AMR44225.1    PCG77697.1    AY618892    AAV33655.1    EF531623    ABR88234.1    PCG77696.1    NWSH01002619    PCG67834.1    AY953058    AAX62031.1    PCG67835.1    EF531624    ABR88235.1    PCG77694.1    KQ459591    KPI97041.1    JTDY01002254    KOB71786.1    HM990178    ADT80826.1    PCG77693.1    Y12279    CAA72958.1    JTDY01005262    KOB67184.1    JN252035    AFM28248.1    NWSH01000651    PCG75015.1    KM083791    ODYU01000971    AIR09772.1    SOQ36530.1    EF531626    ABR88237.1    KQ459252    KPJ02116.1    JQ904139    AFM77769.1    FJ205424    ACR15991.1    EF531625    ABR88236.1    KC175563    AGR92346.1    HM990183    ADT80831.1    GQ354838    ACU00133.1    HM209419    ADI32880.1    GU323796    ADA83701.1    HM209421    ADI32882.1    EF104914    ABP96916.1    EU325550    ACB54940.1    L34168    AAA58743.1    HM209420    ADI32881.1    AF233728    AAF71515.1    JN252036    AFM28249.1    HM209422    ADI32883.1    NWSH01001552    PCG70875.1    AY251276    AAO75039.1    SOQ36529.1    KQ461198    KPJ05938.1    Y12273    CAA72952.1    AGBW02010392    OWR48581.1    AY618895    AAV33658.1    EU673454    ACI45417.1    FJ205412    ACR15980.1    AY618890    AAV33653.1   
Pfam
PF00089   Trypsin        + More
PF00178   Ets
Interpro
IPR001254   Trypsin_dom        + More
IPR018114   TRYPSIN_HIS       
IPR009003   Peptidase_S1_PA       
IPR001314   Peptidase_S1A       
IPR033116   TRYPSIN_SER       
IPR036388   WH-like_DNA-bd_sf       
IPR036390   WH_DNA-bd_sf       
IPR000418   Ets_dom       
SUPFAM
SSF50494   SSF50494        + More
SSF46785   SSF46785       
Gene 3D
PDB
2HLC     E-value=1.54167e-22,     Score=261

Ontologies

Topology

Subcellular location
Nucleus  
SignalP
Position:   1 - 17,         Likelihood:  0.993425
 
 
Length:
284
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.43393
Exp number, first 60 AAs:
0.24718
Total prob of N-in:
0.03903
outside
1  -  284
 
 

Population Genetic Test Statistics

Pi
373.811449
Theta
217.687539
Tajima's D
2.278943
CLR
0.000005
CSRT
0.92070396480176
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
28556443 IVGGSAANAGAHPHLAGLVIALTNGR 100.00 2e-10
28556443 IVGGSAANAGAHPHLAGLVIALTNGR 100.00 2e-10
28556443 INLASGSNNFAGTWAWAAGFGR 100.00 2e-10
28556443 IVGGSAANAGAHPHLAGLVIALTNGR 100.00 2e-10
28556443 IVGGSAANAGAHPHLAGLVIALTNGR 100.00 2e-10
28556443 EEAIELDYHNK 100.00 2e-10
28556443 IVGGSAANAGAHPHLAGLVIALTNGR 100.00 2e-10
28556443 EEPIELDYHIK 100.00 2e-10
28556443 AEEAADFDGTR 100.00 2e-10
28556443 QVSLQVITNAVCAR 100.00 0.013
28556443 QVSLQVITNAVCAR 100.00 0.013
28556443 QVSLQVITNAVCAR 100.00 0.013
28556443 QVSLQVITNAVCAR 100.00 0.013
28556443 QVSLQVITNAVCAR 100.00 0.013
28556443 QVSLQVITNAVCAR 100.00 0.013
28556443 QLIGITSFGSAQGCQR 100.00 0.013
28556443 QVSLQVITNAVCAR 100.00 0.013
28556443 QVSLQVITNAVCAR 100.00 0.013
28556443 QVSLQVITNAVCAR 100.00 0.013
28556443 QVSLQVITNAVCAR 100.00 0.013
28556443 QVSLQVITNAVCAR 100.00 0.013
28556443 QVSLQVITNAVCAR 100.00 0.013
28556443 QLIGITSFGSDR 100.00 0.013
28556443 QVSLQVITNAVCAR 100.00 0.013
28556443 QVSLQVITNAVCAR 100.00 0.013
28556443 QVSLQVITNAVCAR 100.00 0.013
28556443 QVSLQVITNAVCAR 100.00 0.013
28556443 QVSLQVITNAVCAR 100.00 0.013
28556443 QLIGITSFGSAQGCQR 100.00 0.013
28556443 QLIGITSFGSAQGCQR 100.00 0.013
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号