SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10626  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA003957
Annotation
cytochrome_P450_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 2.403
 

Sequence

CDS
ATGATCACTTTAATCTGGTTGGGTGTACTTCTGGTGACACTGACGTTACACCTCAGGAAGGTGTACTCAAGGTTCAAGGATTATGGCGTGAACCACTTCACGCCGATCCCGGTGTTAGGAAACGCTGGTCCAATAACAGTGCGACTTCGGCACGTGGCTGAGGACTTCGATATGGTGTATAAAGCTTTTCCAGAGGACAGGTTCACAGGCAGATTTGACTTGCTGCGGCCCACGGTTATCATCAAAGATTTAGACCTCATAAAGCAGATCACTATAAAAGACTTTGAGCATTTCCTGGACCACAGAGCTTTGGTTGATGACACCGCTGACCCGTTCTTTGGCAGAAACCTATTTTCTTTGAGAGGTCAAGAATGGAAAGACATGCGGTCCACGTTGAGTCCTGCTTTCACCAGCTCCAAGATGCGTGGAATGGTCCCTTTTATGGTGGAAGTTAATAACCAGATGATTGATATGATTAAAAAAAAAATTGTGGCTAATGCGGATGGCTACCTCGACTGTGAAGGTAAAGACCTGACCACTCGCTACGCTAATGACGTCATAGCATCCTGTGCATTCGGCGTCAAGGTGGACTCCCATACCAATGAGGAAAATCAGTTCTATCTTATGGGTAGGGACATGGCGGATTTTGGATTCCGAAAGATTATGGTATTTCTCGGTTACTCTTCGTTCCCGAAATTAATGAAGAAATTCAACGCCAAACTTCTGTCTGATGAGACTGGACATTTCTTCACCGATTTAGTTCTCAGAACGATGGAAGACCGTGAGGTTAAAGAAATTGTGAGACCTGATATGATTCATTTACTGATGGAGGCAAAACAAGGCAAACTTTCTTATGATGAAAAAAGTACTAAAGAGGCTGACACTGGATTTGCAACAGTCGAAGAATCCGATGTCGGAAAAAAGACTATCAATAGAATCTGGTCCAACACCGATTTGATTGCCCAAGCAACCCTCTTCTTCGTGGCTGGCTTTGAGACTATTTCGTCGGCGATGTCGTTTGCACTTCACGAGTTGGCTCTAAACCCTGAAATTCAGGACCGTCTGGTGCAAGAGATCAAGGAAAACTACGCGAAGACTGGGGGGAAATTCGATTTTAACTGTATTCAAGATTTGACTTACATGGATATGTTTGTGTCGGAGGTACTTAGATTGTGGACTCCGGTAGTCGGCATGGATCGTCTCTGCGTCAAAGATTACAATCTGGGAAGAGCGAACAAAAACGCCACTAAAGACTTTATCCTCCGCAAAGGCGAAGGATTGTCTATCCCGACCTGGTCAATCCATCACAATCCTGAATACTACCCCGAACCCTATAAATTTGACCCAGAGCGCTTCTCCGAGGAAAACAAACGGAACATCAAACCGTTCACTTATCTACCATTCGGGACGGGTCCGAGGAATTGTATCGGTTCAAGGTTTGCTCTTTGCGAGGTGAAAGTCATGTTATACCAGCTCCTGCAGCAGATCGAAGTTCTTCCGAGCGACAAGACTAAGGTTCGAGCGAAATTGGCGAAGGATACCTTCAACGTCAAGATCGAAGGAGGCCACTGGATCAGACTCAAGCTTAGGGATTAG
Protein
MITLIWLGVLLVTLTLHLRKVYSRFKDYGVNHFTPIPVLGNAGPITVRLRHVAEDFDMVYKAFPEDRFTGRFDLLRPTVIIKDLDLIKQITIKDFEHFLDHRALVDDTADPFFGRNLFSLRGQEWKDMRSTLSPAFTSSKMRGMVPFMVEVNNQMIDMIKKKIVANADGYLDCEGKDLTTRYANDVIASCAFGVKVDSHTNEENQFYLMGRDMADFGFRKIMVFLGYSSFPKLMKKFNAKLLSDETGHFFTDLVLRTMEDREVKEIVRPDMIHLLMEAKQGKLSYDEKSTKEADTGFATVEESDVGKKTINRIWSNTDLIAQATLFFVAGFETISSAMSFALHELALNPEIQDRLVQEIKENYAKTGGKFDFNCIQDLTYMDMFVSEVLRLWTPVVGMDRLCVKDYNLGRANKNATKDFILRKGEGLSIPTWSIHHNPEYYPEPYKFDPERFSEENKRNIKPFTYLPFGTGPRNCIGSRFALCEVKVMLYQLLQQIEVLPSDKTKVRAKLAKDTFNVKIEGGHWIRLKLRD

Summary

Similarity
Belongs to the cytochrome P450 family.
EMBL
EF535804    ABQ08706.1    EF535806    ABQ08708.2    BABH01036652    BABH01036653    + More
EF491004    AK343209    ABP65279.1    BAM73893.1    AB500115    BAI49180.1    EF535805    ABQ08707.1    AK289300    BAM73827.1    EF535808    ABQ08710.1    BABH01036639    BABH01036640    BABH01036638    EF488994    ABP02071.1    EF542811    ABQ18318.1    EF415298    ABN71369.1    KR095603    AKS48891.1    EU327674    ABY47596.1    KM016750    AID54902.1    KZ149989    PZC75615.1    DQ788840    ABH09253.1    FJ265741    ACJ04711.1    EF535807    ABQ08709.1    AY487948    AAR37015.1    AK289302    BAM73829.1    FN421128    CAZ65619.1    BABH01036637    EF421989    ABO07439.1    AK289297    BAM73824.1    AK289298    BAM73825.1    FJ378716    ACJ05915.1    AB498807    BAI47532.1    AK289299    BAM73826.1    KF701145    AHW57315.1    MH001162    AYW35335.1    AF172279    AAD51036.1    DQ473438    ABF14737.1    GCVX01000068    JAI18162.1    JTDY01003828    KOB68945.1    KP001132    AJN91177.1    AY390260    AAR26518.1    MF684345    ASX93979.1    KR676343    ALJ30298.1    RSAL01000054    RVE50006.1    AF172281    AAD51038.1    NWSH01001322    PCG71702.1    GQ915313    ACZ97407.2    GCVX01000063    JAI18167.1    KY212055    ARA91619.1    MG793355    AYA28074.1    PCG71703.1    NWSH01001758    PCG70237.1    KM016753    AID54905.1    PCG70235.1    KY436738    ARI68318.1    EU541248    ACB30273.2    PCG71704.1    KY348420    ATP15901.1    EU327673    ABY47595.1    PZC75619.1    JX486677    AGI65181.1    AY753201    AAV28704.1    KX443436    ASO98011.1    DQ003275    AAY21809.1    GQ915323    ACZ97417.2    PZC75618.1    FJ416332    ACJ37388.1    GQ465040    ACV88722.1    KM016752    AID54904.1    EU541247    ACB30272.1    AY371318    AAQ73544.1    KQ460779    KPJ12393.1    DQ788839    ABH09252.1    KQ459144    KPJ03683.1    MG793354    AYA28073.1    KX443437    ASO98012.1    KPJ03681.1    KY348419    ATP15900.1    KPJ03682.1    AB381883    BAG71410.1    KJ671577    AID55429.1    AF525031    AAP80766.1    KPJ12394.1    RVE50007.1    FJ227150    ACI43222.1    KF701146    AHW57316.1    KY212054    ARA91618.1    MG793356    AYA28075.1    KY348418    ATP15899.1    AGBW02009651    OWR50238.1    MG793353    AYA28072.1    KP001131    AJN91176.1    KY436739    ARI68319.1    MH138270    AXP17211.1    KM016755    AID54907.1    HQ340240    KX443438    ADP55210.1    ASO98013.1    KJ671579    AID55431.1    PZC75617.1    KX443439    ASO98014.1    KX443440    ASO98015.1    KR095604    AKS48892.1    KJ671578    AID55430.1    KC832920    AHF45921.1    PZC75616.1   
Pfam
PF00067   p450
Interpro
IPR036396   Cyt_P450_sf        + More
IPR002401   Cyt_P450_E_grp-I       
IPR017972   Cyt_P450_CS       
IPR001128   Cyt_P450       
IPR002403   Cyt_P450_E_grp-IV       
SUPFAM
SSF48264   SSF48264       
Gene 3D
PDB
6MA7     E-value=3.12318e-59,     Score=580

Ontologies

Topology

SignalP
Position:   1 - 23,         Likelihood:  0.669546
 
 
Length:
531
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
3.12969000000001
Exp number, first 60 AAs:
2.76087
Total prob of N-in:
0.11034
outside
1  -  531
 
 

Population Genetic Test Statistics

Pi
205.859876
Theta
171.731515
Tajima's D
1.06407
CLR
0.147759
CSRT
0.67921603919804
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
28556443 NLFSLR 100.00 0.016
28556443 STVLDTPSEDR 100.00 0.016
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号