SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10622
Annotation
reverse_ribonuclease_integrase?_partial_[Lasius_niger]
Location in the cell
Mitochondrial   Reliability : 1.365 Nuclear   Reliability : 1.094
 

Sequence

CDS
ATGTTCAAAGCAGTTATTTTATCGACTGTACCGCTGAGGATCAACAGAATAGTGGTTGATGAAGTAGAGAAGCCGCACTCTGCTTGTAGTAAACTTTTTAAAGAATCCTATGAAAAATTCCAGAAATTAAGCAAAAAGGCAGTTGATCCTCTATTAGTTGGTGTATCTAGTTCAGCATCTGCTTCTGTACCTGGCATTCAGGCACCAATTAATGTCGCTGTTACTTGTGATAGAGGTGTTACTTCAGAACTGAGTAGGCTGAAGTTCGATGGTAAGTCATGTGTTCGATCTTTTATTCAACGTGTTTACGAATTTAGCGAGGCGCGTAGCATCCCCGACTCAAAACTTCTCTCATCTGCTACAGAAATATTTACAGATGATGCGCTGCATTGGTTCAGGAGTATTAAGGACCAGGTTTCATCTTGGGATGATCTTGTTGTTCTTTTAAAAAAAGATTTTGATAAAGCAGACTATGATTACCGTTTACTTGCTGAGATTCGTGCTAGGACTCAAGGGGAAACGGAAAATATTACGATATACTTAGCTATTCTCTCGGTTTCCGGCCTTTTGGATTCAGGCTCAGTGGTTACTATTTTAGGCAACAATGCTCATAGTGCATTAGTTAGTCGTGGGCTGGAGTTGTGTACTGATGATAAATTGACTATTATTGCGGCTGGTGGACAAAATCTTAGAAGTATAGGCTATATTAATATGCCAGTGCATTTCGAAAACCAGTTCCACATTATTCAGAGTCACGTAGTTCCAGAAGTTCAATCATCGCTTATTTTAGGGATTGACTTTTGGCACACATTTAAAATTTGCCCGAAGTACTTGAGTTCTCTTCATTTCCCCGGCCCTCCATTGGCTAATTTAGATGTTGGTAGCCCAACCAATTTTTTGCGCTCGTATGATTATTTGGACGAATCACAAAAGGCCGTCGTTGACAATATTACCAAGCAGTTTGAAGAAATATCTTTTGAGCGCAAAGGACTTGGACGCACAAACTTAATTACTCACCACATCGACACGGGGAATTCTCCTCCTGTGAGACAGCGCTACTATAGGCTTTCACCAGAGAAACAGAGAATCCTAGTCGAGCAAGTAGACGAAATGCTCCAGCTTGATGTAGTTGAGCCTTGTGAGAGTGCCTGGCAATCCCCGGTATTGCTAGTCACTAAAAAAGATGGTCAGCCGCGGTTCTGCTTAGATAGTAGGAAGCTAAACTCTGTTACAAAACGCGACGCTTATAACTTACCTTACATATCGGAGATATTGGACAACTTGCGAGACGCGCGCTATCTTAGCAGTATTGACTTATCAAAGGCTTTCTGGCAATTACCAATAGCACTCGAAGATATGGACAAGACGGCATTTTACGTTCCGGGACGAGGGACGTTACGGTTCAAGACTACACCGTTTGGTTTGACCAATGCGCCTTCTACGCAACAGCGGTTAGTCGATTTATTGTTTGGCAACATGGATCACAAGGCGTTCGCATATTTAGATGATGTGATAATAGTAAGTAGCACGTTTGATGAGCATGTTAGTCTTCTTCTTCGCGTGTTAGACAAACTGCGCCATGCTAATCTAACAATTAATTTAGAAAAGTGTGAATTTTTTCGAAGTAAACTTAAATATTTAGGCTATGTGGTCGACGCGAATGGTTTGCGGACTGATCCGGATAAAGTTACAGCCATTCTAAATTACCCAACTCCTACATGTCGTAAGGACTTGAAACGGTTCCTAGGCACGGCAACATGGTACCGGAGATTTGTCCCAAACTTTAGCACTATCGCAGGGCCGCTTAATAGGTTGACATCGAACAAAAAATCAACACCTCCCTTCCAGTGGACAGATGAGGCCGACACTGCGTTCAAAAAACTTAAGGAATCTTTGGTCTCGGCACCTGTCCTCTCCTGCCCAAATTATGATCTGCCTTTCGAAGTCCATACAGATGCAAGTAACTATGGGATAGGTGGTATGCTCACACAAACTATTGAGGGGAAAGAGCACCCTATAGCGTATATGAGCAAGTCCTTATCGGGGGCCGAAAAGAATTATAGCATTACCGAACGTGAGACCTTAGCTGTTCTCGTGGCTCTCGAGCACTGGCGTTGCTATCTGGAGAACGGAAAGACATTCACGGTTTACACAGACCACAGCGCACTTAAGTGGTTCCTTTCCTTGAACAATCCTACGGGTAGGCTTGCACGTTGGGGAGTTCGATTATCGTCGTTTGATTTTGAAATCAAACACCGCCGCGGTGTAGACAATGTGATTCCCGACGCTTTGTCTAGAGCTGTCCCGGTCACTACTATCACTACTGCTAAATCACTCACGACTTCTAGTGATGATTGAAAGCCTTTTGAATTTAATGTAGGAGATACTGTTTATAAACGCGCTTACGTCCTGAGTGACAAAGATAAGTTTTTTAGTAAGAAGTTAGCACCGAAATATATCAAGTGCAAAGTTGTCGAAAAACTCTCGCCACTTGTCTACGTTCTAGAAGACATGTCGGGTAAAAACATAGGCACTTGGCATATTAAAGACTTGAAAATATTAGGACAACACTCATAG
Protein
MFKAVILSTVPLRINRIVVDEVEKPHSACSKLFKESYEKFQKLSKKAVDPLLVGVSSSASASVPGIQAPINVAVTCDRGVTSELSRLKFDGKSCVRSFIQRVYEFSEARSIPDSKLLSSATEIFTDDALHWFRSIKDQVSSWDDLVVLLKKDFDKADYDYRLLAEIRARTQGETENITIYLAILSVSGLLDSGSVVTILGNNAHSALVSRGLELCTDDKLTIIAAGGQNLRSIGYINMPVHFENQFHIIQSHVVPEVQSSLILGIDFWHTFKICPKYLSSLHFPGPPLANLDVGSPTNFLRSYDYLDESQKAVVDNITKQFEEISFERKGLGRTNLITHHIDTGNSPPVRQRYYRLSPEKQRILVEQVDEMLQLDVVEPCESAWQSPVLLVTKKDGQPRFCLDSRKLNSVTKRDAYNLPYISEILDNLRDARYLSSIDLSKAFWQLPIALEDMDKTAFYVPGRGTLRFKTTPFGLTNAPSTQQRLVDLLFGNMDHKAFAYLDDVIIVSSTFDEHVSLLLRVLDKLRHANLTINLEKCEFFRSKLKYLGYVVDANGLRTDPDKVTAILNYPTPTCRKDLKRFLGTATWYRRFVPNFSTIAGPLNRLTSNKKSTPPFQWTDEADTAFKKLKESLVSAPVLSCPNYDLPFEVHTDASNYGIGGMLTQTIEGKEHPIAYMSKSLSGAEKNYSITERETLAVLVALEHWRCYLENGKTFTVYTDHSALKWFLSLNNPTGRLARWGVRLSSFDFEIKHRRGVDNVIPDALSRAVPVTTITTAKSLTTSSDDXKPFEFNVGDTVYKRAYVLSDKDKFFSKKLAPKYIKCKVVEKLSPLVYVLEDMSGKNIGTWHIKDLKILGQHS

Summary

Pfam
PF00078   RVT_1        + More
PF00665   rve
PF17921   Integrase_H2C2
PF17919   RT_RNaseH_2
Interpro
IPR001995   Peptidase_A2_cat        + More
IPR041577   RT_RNaseH_2       
IPR001584   Integrase_cat-core       
IPR001969   Aspartic_peptidase_AS       
IPR012337   RNaseH-like_sf       
IPR021109   Peptidase_aspartic_dom_sf       
IPR036397   RNaseH_sf       
IPR041588   Integrase_H2C2       
IPR000477   RT_dom       
SUPFAM
SSF53098   SSF53098        + More
SSF50630   SSF50630       
Gene 3D
ProteinModelPortal
PDB
4OL8     E-value=2.12263e-70,     Score=678

Ontologies

Topology

Length:
858
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.698029999999997
Exp number, first 60 AAs:
0.0048
Total prob of N-in:
0.03035
outside
1  -  858
 
 

Population Genetic Test Statistics

Pi
394.037777
Theta
187.658874
Tajima's D
3.255345
CLR
0.231686
CSRT
0.988850557472126
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号