SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10607
Pre Gene Modal
BGIBMGA009225
Annotation
PREDICTED:_uncharacterized_protein_LOC105843021_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 3.3
 

Sequence

CDS
ATGAGAACTAGCCACTCACAGTATTTAACAATGGTGGAATTTATGGAAGCAAATGGAGATTTATCAAAACCATCAGGCGGTCCACGAGGTCGCAATTTTATACAGATGAAGTGGAAAGAGTTAACGGGATTACTAAATAGCGATTCTTCAGGAGATCCTAAGAGTGAGGACAAATGGCGTAAGGTGTGGAGTGATTATAAGAATAATTGCAAGAAAAAGTGTGCTAAAATTAATAGAGCTGCTAGTGGCACTGGTGGCGGACCAGCGCTCCATTTATTATTGACTGACCAAGAACAAAGGGTCATGCAGATAATTGGAGTGCAGGCAGCTACTGGCATGGAGATAAAAGAAGCTGGGTTTCCACAAGAAGAAATTTCAACTGAGATGCCAAATACTCAAATTATTTTAAAGGAACCGGAAATAGATTGGAATGCTCCTAGCACAAGCAGCCAACCAACAGTGGCTCCACCACCACCAACTGAGGCTCCCCCTCCAGTCATTAACGAGGAAGAGGAGTGGAACCCTCCGCCGCAGAAAAAAAGAAAAAACAATTTAACAAAAATGTTTTTAGATATAGACAGAAAGGCAAGGGAGTATGCTTCAGAGCGTGATAGGGTATATGAGGAATTAGAAAGAGATCGGTTGAGAGTTAGAGAATTTGAGGTACGTGAAAGAGTAAGACAGAGAGATGAAGAGCTACGGATGCAGGGTCAATGGCTGGAATTTATGAAAGAGGCAATGGAAGCTTTTGTGAGGTTTATGGAGAGAAAGTCTTAA
Protein
MRTSHSQYLTMVEFMEANGDLSKPSGGPRGRNFIQMKWKELTGLLNSDSSGDPKSEDKWRKVWSDYKNNCKKKCAKINRAASGTGGGPALHLLLTDQEQRVMQIIGVQAATGMEIKEAGFPQEEISTEMPNTQIILKEPEIDWNAPSTSSQPTVAPPPPTEAPPPVINEEEEWNPPPQKKRKNNLTKMFLDIDRKAREYASERDRVYEELERDRLRVREFEVRERVRQRDEELRMQGQWLEFMKEAMEAFVRFMERKS

Summary

Pfam
PF13873   Myb_DNA-bind_5
Interpro
IPR028002   Myb_DNA-bind_5        + More
IPR026753   NAIF1       

Ontologies

Topology

Length:
258
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.05775
Exp number, first 60 AAs:
0
Total prob of N-in:
0.16881
outside
1  -  258
 
 

Population Genetic Test Statistics

Pi
148.583425
Theta
185.037233
Tajima's D
-0.643656
CLR
0
CSRT
0.207739613019349
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号