Gene

KWMTBOMO10548

Pre Gene Modal

BGIBMGA007140

Annotation

PREDICTED:_cryptochrome_1_isoform_X1_[Bombyx_mori]

Location

Bomo_Chr17(+):13722702-13750666      View in EpiBrowser

Full name

Cryptochrome-1      

Alternative Name

Blue light photoreceptor

Location in the cell

Cytoplasmic   Reliability : 1.448 Mitochondrial   Reliability : 1.329

CDS

ATGCTTGGCGGTAGCGTTCTGTGGTTCCGTCACGGGCTGCGTCTCCACGACAATCCGTCTCTTCATTCGGCGTTGGAAGAAACGAGCGGCCCTTTCTTTCCCATTTTCATTTTTGACGGGGAAACTGCTGGAACGAAAGTGGTCGGGTACAACCGAATGCGGTACTTGCTAGAAGCGTTAGATGATTTGGACAAGCAATTCAAGAAGTACGGCGGAAGATTACTCCTTGTTAAAGGGAAACCCAGTGCTGTGTTCCGCAGACTCTGGGAAGAATTTGGTATTCGGAAGTTGTGCTTCGAACAGGACTGCGAGCCGGTGTGGCGTCCCAGGGACGAGAGCGTGAAGACGGCGTGCCGCGAGATCGGGGTCACGTGTCGGGAGCACGTGTCGCACACCCTGTGGGAGCCCGACACCGTCATCAAAGCGAACGGGGGAATACCGCCGCTCACGTACCAAATGTTTCTGCATACTGTGGCGACCATCGGTGACCCGCCGCGGCCTGTCGACAACGCCAAACTCCGCGGTATTAAGTTCGGTACATTGCCGCTGTGTTTCTATGAAGAATTCACTGTTTACGACAAGGTGCCGAATCCCGAAGACCTCGGAGTGTTTCTCGAAAACGAAGACATCCGGATGATACGTTGGGTCGGTGGCGAGACGGCCGCCTTGAAGCAGATGCAACATCGACTCGCCGTCGAATACGAGACGTTCTGCAGAGGTTCCTATCTACCGACGCACGGCAGCCCCGACCTCCTCGGGCCTCCGATATCGCTGAGTCCCGCTCTACGGTTCGGATGCCTCTCCGTTAGGAAATTTTACTGGTCGCTCCAGGATTTGTTCCAGCAAGTGCACCAGGGAAGCTTGTGTTCTACTCAATACATTACCGGTCAGTTGATATGGCGCGAGTACTTCTACACGATGAGTGTGAACAATCCTCATTACGGACAGATGACTGACAACCCTATTTGCTTGGACATCCCCTGGAAAAGCCCTGAGGGAGATGAACTGGAGAGATGGGCGTCGGGGCGCACGGGGTTCCCGTTCGTGGACGCGGCCATGCGGCAGCTCCGGCTGGAGGGCTGGCTGCACCACGCCGTGCGGAACACCGTCGCCTCCTTCCTCACGCGCGGCACTCTGTGGCTCTCCTGGGAGCACGGGCTCGCGCACTTCCTCAAGTACCTGCTCGACGCCGACTGGTCCGTGTGCGCCGGCAACTGGATGTGGGTGTCCAGTAGCGCCTTCGAAGCGTTGCTGGACTCGGGCGAGTGCGCGTGTCCAGTGCGACTGGGCCAGCGGCTCGACCCCAGCGGCGAGTACGTGCGGCGCTACGTGCCCGAGCTGGCGCGGGTGCCGACCGAATACATCTACGAGCCCTGGAAAGCGCCTCTGGACGTGCAAGAACGTGCCAACTGTATAATAGGCAAGGACTATCCCGCGCCTGTGGTCAATCATATCGTAGCTGCGCAGCGCAACAGAAACGCCATGGAGGAATTACGCATGCTTCTGGAAAAAGCGCCACCGCATTGCTGTCCGTCGTCAGAGGATGAAATCAGGCAATTCATGTGGCTTAACGAATAG

Protein

MLGGSVLWFRHGLRLHDNPSLHSALEETSGPFFPIFIFDGETAGTKVVGYNRMRYLLEALDDLDKQFKKYGGRLLLVKGKPSAVFRRLWEEFGIRKLCFEQDCEPVWRPRDESVKTACREIGVTCREHVSHTLWEPDTVIKANGGIPPLTYQMFLHTVATIGDPPRPVDNAKLRGIKFGTLPLCFYEEFTVYDKVPNPEDLGVFLENEDIRMIRWVGGETAALKQMQHRLAVEYETFCRGSYLPTHGSPDLLGPPISLSPALRFGCLSVRKFYWSLQDLFQQVHQGSLCSTQYITGQLIWREYFYTMSVNNPHYGQMTDNPICLDIPWKSPEGDELERWASGRTGFPFVDAAMRQLRLEGWLHHAVRNTVASFLTRGTLWLSWEHGLAHFLKYLLDADWSVCAGNWMWVSSSAFEALLDSGECACPVRLGQRLDPSGEYVRRYVPELARVPTEYIYEPWKAPLDVQERANCIIGKDYPAPVVNHIVAAQRNRNAMEELRMLLEKAPPHCCPSSEDEIRQFMWLNE

Description

Blue light-dependent regulator that is the input of the circadian feedback loop. Has no photolyase activity for cyclobutane pyrimidine dimers or 6-4 photoproducts. Regulation of expression by light suggests a role in photoreception for locomotor activity rhythms. Functions, together with per, as a transcriptional repressor required for the oscillation of peripheral circadian clocks and for the correct specification of clock cells. Genes directly activated by the transcription factors Clock (Clk) and cycle (cyc) are repressed by cry (By similarity).
Blue light-dependent regulator that is the input of the circadian feedback loop. Has no photolyase activity for cyclobutane pyrimidine dimers or 6-4 photoproducts. Regulation of expression by light suggests a role in photoreception for locomotor activity rhythms. Light induces the degradation of cry, likely due to conformational change in the photoreceptor leading to targeting to the proteasome. Under circadian regulation, expression is influenced by the clock pacemaker genes period, timeless, Clock and cycle. Binding to tim irreversibly commits tim to proteasomal degradation. Functions, together with per, as a transcriptional repressor required for the oscillation of peripheral circadian clocks and for the correct specification of clock cells. Genes directly activated by the transcription factors Clock (Clk) and cycle (cyc) are repressed by cry. Necessary for light-dependent magnetosensitivity, an intact circadian system is not required for the magnetoreception mechanism to operate. Required for both the naive and trained responses to magnetic field, consistent with the notion that Cry is in the input pathway of magnetic sensing (By similarity).
Blue light-dependent regulator that is the input of the circadian feedback loop. Has no photolyase activity for cyclobutane pyrimidine dimers or 6-4 photoproducts. Regulation of expression by light suggests a role in photoreception for locomotor activity rhythms. Functions, together with per, as a transcriptional repressor required for the oscillation of peripheral circadian clocks and for the correct specification of clock cells. Genes directly activated by the transcription factors Clock (Clk) and cycle (cyc) are repressed by cry. Necessary for light-dependent magnetosensitivity, an intact circadian system is not required for the magnetoreception mechanism to operate. Required for both the naive and trained responses to magnetic field, consistent with the notion that cry is in the input pathway of magnetic sensing.

Cofactor

FAD

Subunit

Interacts with tim and per; promoted by light conditions.
Interacts with tim and per; promoted by light conditions (PubMed:10417378, PubMed:11448767). Interaction with tim irreversibly commits tim to proteasomal degradation (PubMed:10417378). Interacts with l(1)G0136/CG8198 (PubMed:26569474).

Miscellaneous

Unstable upon light exposure. Light induces the degradation of cry, likely due to conformational change in the photoreceptor leading to targeting to the proteasome.
Appears to bind 5,10-methenyltetrahydrofolate at substoichiometric levels.

Similarity

Belongs to the DNA photolyase class-1 family.

Keywords

Biological rhythms   Chromophore   Complete proteome   Cytoplasm   FAD   Flavoprotein   Nucleotide-binding   Nucleus   Photoreceptor protein   Receptor   Reference proteome   Repressor   Sensory transduction   Transcription   Transcription regulation   3D-structure  

Feature

chain  Cryptochrome-1

Uniprot

E1AFY0   H9JC95   Q9BMD6   V6BRH0   Q29SR5   M4IS17   + More
H2EP72   A0A2H4ZRS6   E2D7U6   A0A2A4JDA8   A0A194PPT2   M4IQ92   J9T2S0   I1ZEF7   Q2TJN5   A0A212EI23   F1CEX5   A0A2H1V8Q6   Q2XUS9   A0A194RJZ3   A0A1B6CJU7   A0A2P1MAF3   A0A0H3VDD4   A0A182QV50   A0A336LU52   A0A182N4C3   A0A1Q3G4I6   A0A1Y1BCW8   A0A182RXJ3   A0A182K7M7   Q17DK5   A0A182VR37   A0A182LWP3   A0A182PQU3   A0A182J9E4   U5EW87   A0A2K7P694   A0A084VS55   A2A264   A0A2M4BJL9   W5J665   A0A182KLX8   A0A182XBG1   Q7PYI7   A0A182UYG9   A0A182I0A1   A0A2M4BJE4   A0A2M4BJJ5   A0A182ULF2   A0A2M4AAF9   A0A182F877   A0A2M3Z2I5   A0A1A9WJ94   A0A0L0BVA4   A0A146LJ78   A0A0A1XFQ1   A0A034WDB9   D2Z049   B6VCA5   W8BXG5   B4LZK8   A0A0K8W019   A0A1W4W950   D3TP74   A0A1A9Y6P0   B4KD21   W8C901   A0A1B0G7Z0   A0A1B0BNK4   Q64F97   B3P361   B4IHX7   B4JUX6   D2Z048   B4GLT4   Q293P8   B4NIT5   A0A1A9ZHL6   A0A1A9VB87   B4PMT0   B4QTF9   A0A3B0KFE6   O77059   B3M2F1   T1DQK4   A0A0K8TKW9   A0A182G185   A0A0M4EPM8   T1PEJ3   A0A2M4BK82   A0A1I8MYU7   A0A348AY31   A0A1I8PPM0   A0A1J1HXN3   A0A182YG99   A0A3R7N039   A0A0A9W7T6   A0A286Q179   D2T2J6  

Pubmed

19121390    17244599    16640724    23448062    26354079    16332522    + More
22118469    29136191    29541034    26227859    17510324    24438588    20920257    23761445    20966253    12364791    26108605    26823975    25830018    25348373    20010960    24495485    17994087    20353571    15611172    15632085    17550304    9845369    10063806    10731132    12537572    12537569    9845370    10233998    10417378    11448767    15258584    16527739    17298948    18641630    18597555    26569474    23746849    23518567    26369729    26483478    25315136    25244985    25401762    29255161   

EMBL

HM747057    HM747059    ADM86932.1    BABH01015107    BABH01015108    AF333998    + More
AAK11644.1    HG780135    CDK02014.2    AY947639    AAY23345.1    JQ713132    AGA11658.1    JN997418    JQ713131    JQ713134    JQ713135    AEX49898.1    AGA11657.1    AGA11660.1    AGA11661.1    KY491538    AUG44605.1    GQ896502    ADN94464.1    NWSH01001875    PCG69829.1    KQ459603    KPI93140.1    JQ713133    AGA11659.1    JX077108    AFR54426.1    JQ616846    AFJ22638.1    AY860425    AAX58599.1    AGBW02014713    OWR41136.1    HQ234484    HQ234485    ADY17887.1    ADY17888.1    ODYU01001068    SOQ36792.1    DQ243705    ABB52818.2    KQ460124    KPJ17655.1    GEDC01023693    GEDC01004666    JAS13605.1    JAS32632.1    MG356483    QKKF02000897    AVP27638.1    RZF48875.1    KM108579    AJY53623.1    AXCN02000032    UFQS01000197    UFQT01000197    SSX01192.1    SSX21572.1    GFDL01000369    JAV34676.1    LC202047    BAX56238.1    CH477293    EAT44496.1    AXCM01002035    GANO01001533    JAB58338.1    ATLV01015816    KE525036    KFB40799.1    AB291231    BAF45421.1    GGFJ01004010    MBW53151.1    ADMH02002026    ETN59907.1    DQ219482    AAAB01008987    ABB29886.1    EAA01270.4    APCN01002057    GGFJ01004011    MBW53152.1    GGFJ01004012    MBW53153.1    GGFK01004473    MBW37794.1    GGFM01001975    MBW22726.1    JRES01001290    KNC23908.1    GDHC01010508    JAQ08121.1    GBXI01004521    JAD09771.1    GAKP01006822    JAC52130.1    AB517608    BAI67363.1    FJ373353    ACJ08741.1    GAMC01002598    JAC03958.1    CH940650    EDW67147.1    GDHF01007837    JAI44477.1    EZ423226    ADD19502.1    CH933806    EDW13791.1    GAMC01002599    JAC03957.1    CCAG010010580    JXJN01017441    AY708049    AAU14170.1    CH954181    EDV48513.1    CH480840    EDW49494.1    CH916374    EDV91296.1    AB517607    BAI67362.1    CH479185    EDW38508.1    CM000070    CH964272    EDW83799.1    CM000160    EDW96000.1    CM000364    EDX12361.1    OUUW01000008    SPP83781.1    AF099734    AB018400    AB019389    AE014297    AY051514    AAC83828.1    AAF55649.1    AAK92938.1    BAA33787.1    BAA35000.1    CH902617    EDV43404.1    GAMD01001110    JAB00481.1    GDAI01002800    JAI14803.1    JXUM01136342    KQ568414    KXJ69012.1    CP012526    ALC47765.1    KA646550    AFP61179.1    GGFJ01004329    MBW53470.1    LC320665    BBD05665.1    CVRI01000020    CRK90905.1    QCYY01002004    ROT73690.1    GBHO01042684    JAG00920.1    KX238951    KY922999    ANW48376.1    AUI80370.1    ABLF02032292    FN377569    CAY26038.1   

Proteomes

UP000005204    UP000218220    UP000053268    UP000007151    UP000053240    UP000291343    + More
UP000075886    UP000075884    UP000075900    UP000075881    UP000008820    UP000075920    UP000075883    UP000075885    UP000075880    UP000030765    UP000000673    UP000075882    UP000076407    UP000007062    UP000075903    UP000075840    UP000075902    UP000069272    UP000091820    UP000037069    UP000008792    UP000192221    UP000092443    UP000009192    UP000092444    UP000092460    UP000008711    UP000001292    UP000001070    UP000008744    UP000001819    UP000007798    UP000092445    UP000078200    UP000002282    UP000000304    UP000268350    UP000000803    UP000007801    UP000069940    UP000249989    UP000092553    UP000095301    UP000095300    UP000183832    UP000076408    UP000283509    UP000007819   

PRIDE

E1AFY0    H9JC95    Q17DK5    Q293P8    O77059   

Pfam

PF00875   DNA_photolyase        + More
PF03441   FAD_binding_7

Interpro

IPR005101   Cryptochr/Photolyase_FAD-bd        + More
IPR006050   DNA_photolyase_N       
IPR036155   Crypto/Photolyase_N_sf       
IPR002081   Cryptochrome/DNA_photolyase_1       
IPR014729   Rossmann-like_a/b/a_fold       
IPR036134   Crypto/Photolyase_FAD-like_sf       
IPR018394   DNA_photolyase_1_CS_C       

SUPFAM

SSF48173   SSF48173        + More
SSF52425   SSF52425       

Gene 3D

3.40.50.620    

ProteinModelPortal

E1AFY0   H9JC95   Q9BMD6   V6BRH0   Q29SR5   M4IS17   + More
H2EP72   A0A2H4ZRS6   E2D7U6   A0A2A4JDA8   A0A194PPT2   M4IQ92   J9T2S0   I1ZEF7   Q2TJN5   A0A212EI23   F1CEX5   A0A2H1V8Q6   Q2XUS9   A0A194RJZ3   A0A1B6CJU7   A0A2P1MAF3   A0A0H3VDD4   A0A182QV50   A0A336LU52   A0A182N4C3   A0A1Q3G4I6   A0A1Y1BCW8   A0A182RXJ3   A0A182K7M7   Q17DK5   A0A182VR37   A0A182LWP3   A0A182PQU3   A0A182J9E4   U5EW87   A0A2K7P694   A0A084VS55   A2A264   A0A2M4BJL9   W5J665   A0A182KLX8   A0A182XBG1   Q7PYI7   A0A182UYG9   A0A182I0A1   A0A2M4BJE4   A0A2M4BJJ5   A0A182ULF2   A0A2M4AAF9   A0A182F877   A0A2M3Z2I5   A0A1A9WJ94   A0A0L0BVA4   A0A146LJ78   A0A0A1XFQ1   A0A034WDB9   D2Z049   B6VCA5   W8BXG5   B4LZK8   A0A0K8W019   A0A1W4W950   D3TP74   A0A1A9Y6P0   B4KD21   W8C901   A0A1B0G7Z0   A0A1B0BNK4   Q64F97   B3P361   B4IHX7   B4JUX6   D2Z048   B4GLT4   Q293P8   B4NIT5   A0A1A9ZHL6   A0A1A9VB87   B4PMT0   B4QTF9   A0A3B0KFE6   O77059   B3M2F1   T1DQK4   A0A0K8TKW9   A0A182G185   A0A0M4EPM8   T1PEJ3   A0A2M4BK82   A0A1I8MYU7   A0A348AY31   A0A1I8PPM0   A0A1J1HXN3   A0A182YG99   A0A3R7N039   A0A0A9W7T6   A0A286Q179   D2T2J6  

PDB

4JZY     E-value=4.58816e-179,     Score=1613

KEGG

100500923    K02295 cryptochrome | (RefSeq) cry1; cryptochrome 1

GO

GO:0016829   GO:0018298   GO:0048511   GO:0005641   GO:0050660   GO:0048471   GO:0005634   GO:0045892   GO:0009882   GO:0005737   GO:0042752   GO:0071949   GO:0042332   GO:0050980   GO:0045187   GO:0007602   GO:0071000   GO:0032922   GO:0045475   GO:0032991   GO:0043153   GO:0009649   GO:0009881   GO:0009588   GO:0008020   GO:0071482   GO:0009416   GO:0048512   GO:0009637   GO:0005654   GO:0050958   GO:0005829   GO:0009785   GO:0007623  

Subcellular location

Cytoplasm   Nuclear translocation initiates after the perception of a light signal.   With evidence from 1 publications.
Perinuclear region   Nuclear translocation initiates after the perception of a light signal.   With evidence from 1 publications.
Nucleus   Nuclear translocation initiates after the perception of a light signal.   With evidence from 1 publications.

Length:

525

Number of predicted TMHs:

0

Exp number of AAs in TMHs:

0.00178

Exp number, first 60 AAs:

0.00059

Total prob of N-in:

0.00031

outside

1  -  525

 

 

Pi

31.147786

Theta

173.051471

Tajima's D

-2.009219

CLR

0.897672

CSRT

0.0149992500374981

Interpretation

Possibly Positive selection