SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10479
Annotation
PREDICTED:_uncharacterized_protein_LOC106133666_[Amyelois_transitella]
Location in the cell
Nuclear   Reliability : 1.992
 

Sequence

CDS
ATGTTTTGTGATTTTGGTGGTTCTTCAGACTTCACGCCAATCGCCTTAGATGGTGTATCCCTGCCAGTCTGCTCCGACTTCAAGTACCTCGGCTCTATACTCCAGAACGACGGCAACATAGACCGGGACGTCACAAATAGAATAAACGCTGGTTGGATGAAATGGCGACAGGTCTCTGCAACAGCATGCGATCGTAGAATGCCCCTTCAGCTCAAGGGCAAAATTTACAAAACGATCATTAGACCTGTCGTGCTGTATGGATCTGAGTGTTGGGCGACGAAAGTTAAGCATGAAAGAGGAGTGCATGCGGCAGAGATGCGAATGTTGAGATGGTTGTGTGGAGTAACAAGAATGGATAAGATAAAGAATAAGTATATCAGAGGAAGTGTGAAAGTGGCCCCGGTAAACAACAAATTAAGGAGCGGACGGTTAGCGTGGTATGGACATGTGATGCGTAGAGAGAAGATGCATGTGACTAGGAGATGTATGGAAATGGTAGTGCAAGGTAGAGGGGGAAGAGGTCGACCGAAGAAGACATGGATGGAGTGTGTGAATAACGATATGAGAGAGAGAGGAGTGAGTGTTGAGATGACGGCTGATAGAAGAGAATGGAAGAGAAAAATTAGTTGTGCCGACCCCACATAG
Protein
MFCDFGGSSDFTPIALDGVSLPVCSDFKYLGSILQNDGNIDRDVTNRINAGWMKWRQVSATACDRRMPLQLKGKIYKTIIRPVVLYGSECWATKVKHERGVHAAEMRMLRWLCGVTRMDKIKNKYIRGSVKVAPVNNKLRSGRLAWYGHVMRREKMHVTRRCMEMVVQGRGGRGRPKKTWMECVNNDMRERGVSVEMTADRREWKRKISCADPT

Summary

EMBL
NWSH01004369    PCG65177.1    NWSH01000612    PCG75311.1    JARK01001564    EYB89718.1    + More
EYB89719.1    KZ452013    PKA51430.1    KZ451888    PKA66013.1    JARK01001594    EYB87754.1    JARK01001437    EYC02289.1    JARK01001582    EYB88469.1    KZ451885    PKA66495.1    KZ452012    PKA51832.1    JARK01001473    EYB97757.1    JARK01001345    EYC27463.1    PKA51807.1    JARK01001413    EYC06291.1    JARK01001546    EYB91135.1    EYC06288.1    NCKU01002988    RWS08398.1    KZ452023    PKA50536.1    JARK01001642    EYB85037.1    JARK01000157    EYC41778.1    JARK01001358    EYC20465.1    AGCT01024946    KYP77525.1    EYB91138.1    KZ502235    PKU81499.1    KZ501974    PKU85733.1    JARK01001486    EYB96487.1    JARK01001529    EYB92481.1    JARK01001478    EYB97301.1    JARK01001348    EYC24955.1    KZ502741    PKU73550.1    JARK01001383    EYC12479.1    DQ070849    ABB00038.1    JARK01001626    EYB85828.1    JARK01000002    EYC46303.1    KZ503176    PKU67611.1    JARK01000211    EYC40457.1    JARK01001455    EYB99857.1    JARK01001362    EYC18796.1    KZ502716    PKU73925.1    KZ453102    PKA47709.1    CM007649    ONM35621.1    CM000781    AQK66095.1    AQK67441.1    JARK01001346    EYC26232.1    EYC46273.1    CM000780    CM007650    AQK52712.1    ONM54013.1    CM007648    ONM19028.1    KZ503459    PKU63885.1    JARK01001356    EYC20868.1    CM008050    PAN29912.1    JARK01000001    EYC46334.1    JARK01001453    EYC00158.1    JARK01001391    EYC10519.1    KZ503020    PKU69639.1    JARK01000103    EYC43100.1    KZ502732    KZ501922    KZ501830    PKU73666.1    PKU86798.1    PKU87987.1    GEDG01001285    JAP37101.1    KZ503527    PKU63110.1    PKU81488.1    KZ502564    KZ502519    KZ502203    PKU76010.1    PKU77283.1    PKU82246.1    JARK01000474    EYC36617.1    CM008054    PVH32202.1    EYC26231.1    JARK01000458    EYC36771.1    AQK64650.1    KZ502242    PKU81438.1    PAN30387.1    JARK01000005    EYC46180.1    FJ265554    ADI61822.1    BT088057    ACR38410.1    KZ504148    PKU59166.1    CU462842    CBA11992.1    NCVQ01000005    PWZ29813.1    ONM13079.1    NCVQ01000004    PWZ31071.1    JARK01001524    EYB92930.1    CM008052    PVH34896.1    JARK01001410    EYC06740.1    CM009749    PUZ76420.1    AQK76494.1    JARK01000189    EYB85038.1    EYC40926.1    KZ502668    PKU74878.1    NCVQ01000006    PWZ23087.1    NCVQ01000008    PWZ13007.1    AQK62700.1    JARK01001340    EYC31308.1    PUZ76291.1    PAN45362.2    JARK01001617    EYB86334.1    JARK01001432    EYC02999.1    JARK01000517    EYC36246.1    NCVQ01000003    PWZ38398.1    EYC46181.1    ONM25835.1    JARK01001678    EYB83113.1    JARK01001374    EYC15074.1    CM008047    PVH63795.1    JARK01000257    EYC39401.1   
Pfam
PF00078   RVT_1        + More
PF03372   Exo_endo_phos
PF01138   RNase_PH
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR027408   PNPase/RNase_PH_dom_sf       
IPR020568   Ribosomal_S5_D2-typ_fold       
IPR001247   ExoRNase_PH_dom1       
SUPFAM
SSF56219   SSF56219        + More
SSF54211   SSF54211       
Gene 3D
ProteinModelPortal

Ontologies

Topology

Length:
214
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00582
Exp number, first 60 AAs:
0.00546
Total prob of N-in:
0.01836
outside
1  -  214
 
 

Population Genetic Test Statistics

Pi
233.461053
Theta
162.443076
Tajima's D
1.403685
CLR
0.337228
CSRT
0.763911804409779
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号