SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10476
Annotation
PREDICTED:_uncharacterized_protein_LOC106143260_[Amyelois_transitella]
Location in the cell
Nuclear   Reliability : 3.973
 

Sequence

CDS
ATGCAGTCCGAAGCTACCGACGATGTGCTACTGGGAGGAACCTACCGTGTAGGAGTGAAGACGCCTAAGTTCAACCCCGAAGACCCAGAACTGTGGTTTGCTCAGCTGGAAGGGCAGTTCACCTTGTCCAATATAAGCGCAGACGCCACGAAGTTCTACTACGTGTTGTCGCAACTGGAACCGCAGCATGCAGCAGAAATCCGGGAGTTGATCGTGTCACCTCCAGCCACCAACAAATATGAGACGATCAAACATGAACTCATACGGAGATTATCAGCTTCGCAAGAAAAGAAGATTAAGCAATTGTTGATGCATGAGGAGATGGGAGATCGCAAACCTACACAGTTCCTTCGACACCTGCAGCTTCTGGCCGGAGAAAATGTTCCGAGCGACTTCATCCGCACCATCTGGGCAAGTCGCTTACCTACTCATCTGCAGACATGCATAGCAGCGCAGCAAACTAAGATGTCACTAGAAGATTTAGCCGAACTTGCAGATCGTGTCAATGATGTCGTTCCAGTAACCATGCAAGTAGCAAGTCAAGTAGCCAGTTTGTCAACATCTGCTGTCATACCAAGCACCATTGACGCGTTGACCCGTAAAGTGGAGGAACTCAGTCGAAAACTCGAGACTATGAGTATGGATCTACGCAGACGCCCACGGCCACGCTTTAAAGAAAGTTGGAACTCAAGAAGTCGCTCACGTTCCCGTTCTCGTCCAAGCGATCATCCATACTGCTTCTTCCACTACCGCTTTGGAGAGCGAGCAAGAAGATGCACCCAGCCATGTACCTACCAGAAGGCGGGAAACTCCCAAGGCAGCCAATAG
Protein
MQSEATDDVLLGGTYRVGVKTPKFNPEDPELWFAQLEGQFTLSNISADATKFYYVLSQLEPQHAAEIRELIVSPPATNKYETIKHELIRRLSASQEKKIKQLLMHEEMGDRKPTQFLRHLQLLAGENVPSDFIRTIWASRLPTHLQTCIAAQQTKMSLEDLAELADRVNDVVPVTMQVASQVASLSTSAVIPSTIDALTRKVEELSRKLETMSMDLRRRPRPRFKESWNSRSRSRSRSRPSDHPYCFFHYRFGERARRCTQPCTYQKAGNSQGSQ

Summary

EMBL
NWSH01002598    PCG67884.1    ODYU01011787    SOQ57731.1    GDQN01009305    JAT81749.1    + More
NWSH01000267    PCG77880.1    LBMM01012479    KMQ86203.1    GEZM01017686    JAV90494.1    LBMM01012075    KMQ86422.1    LBMM01009142    KMQ88358.1    KQ980726    KYN14011.1    LBMM01013103    KMQ85816.1    LBMM01018089    KMQ83878.1    KQ981018    KYN10257.1    KQ979048    KYN23218.1    KQ981301    KYN43041.1    LHQN01021927    LHQN01025379    KOC58628.1    KOC58659.1    AGBW02008172    OWR54062.1    KQ414987    KOC58988.1    GL447057    EFN86960.1    NEVH01003759    PNF40011.1    NEVH01014357    PNF27922.1    KQ980296    KYN16851.1    KQ434816    KZC06854.1    NEVH01023981    PNF17578.1    KQ434992    KZC13185.1    KL367519    KFD66949.1    NEVH01013558    PNF28672.1    KQ414874    KOC59935.1    NEVH01000707    PNF43124.1    KL363297    KFD48322.1    KQ972957    KXZ75711.1    KQ976962    KYN06788.1    KL367555    KFD64488.1    LHQN01026442    KQ414593    KOC58672.1    KOC70162.1    MRZV01001674    PIK36447.1    KQ979103    KYN22624.1    MRZV01001127    MRZV01000236    PIK40395.1    PIK54731.1    KQ414761    KOC61433.1    NEVH01011195    PNF31836.1    KL367564    KFD63933.1    MRZV01000025    PIK61772.1    LBMM01012923    LBMM01012917    KMQ85926.1    KMQ85930.1    KQ415240    KOC58703.1    GAMC01010905    JAB95650.1    NEVH01024424    PNF17276.1    KL367562    KFD64085.1    NEVH01026435    PNF14140.1    KQ434784    KZC04993.1    HE601624    CCD74711.1    HE601627    CCD79076.1    CABG01000076    CCD60595.1    CABG01000094    CCD60852.1    CABG01000020    CCD59058.1    HE601625    HE601629    HE601631    CCD77013.1    CCD77288.1    CCD80388.1    CCD80486.1    CCD81882.1    HE601630    CCD75315.1    CCD80887.1    CCD81548.1    BN000802    CAJ00249.1    CCD80612.1    CCD75326.1    CCD79184.1    CCD79457.1    CCD80464.1    CCD81588.1    CCD75122.1    CCD76048.1    CABG01000031    CCD59329.1    AY813761    AAW25493.1    CCD76553.1    CCD83017.1    CABG01000123    CAZ30728.1    CABG01000177    CAZ30951.2    CCD80379.1    KL250698    KGB35593.1    KL252020    KGB41652.1    HE601626    CCD78440.1    CABG01000053    CCD60106.1    CABG01000063    CCD60342.1    ACPB03037918    CABG01000084    CAZ28664.1    CABG01000047    CCD59971.1    CCD81487.1    CABG01000090    CCD60804.1    NEVH01019603    PNF22346.1    UZAI01017274    VDP22787.1    CABG01000017    CCD58980.1    CCD75389.1    CABG01000015    CCD58945.1   
Pfam
PF17921   Integrase_H2C2        + More
PF00665   rve
PF00078   RVT_1
PF17919   RT_RNaseH_2
Interpro
IPR021109   Peptidase_aspartic_dom_sf        + More
IPR012337   RNaseH-like_sf       
IPR001584   Integrase_cat-core       
IPR001995   Peptidase_A2_cat       
IPR041588   Integrase_H2C2       
IPR036397   RNaseH_sf       
IPR000477   RT_dom       
IPR041577   RT_RNaseH_2       
IPR001969   Aspartic_peptidase_AS       
SUPFAM
SSF50630   SSF50630        + More
SSF53098   SSF53098       
Gene 3D

Ontologies

Topology

Length:
275
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0023
Exp number, first 60 AAs:
0.00025
Total prob of N-in:
0.03536
outside
1  -  275
 
 

Population Genetic Test Statistics

Pi
230.642287
Theta
107.288311
Tajima's D
3.589916
CLR
0.359159
CSRT
0.996250187490625
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号