SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10417
Annotation
Retrovirus-related_Pol_polyprotein_from_transposon_TNT_1-94_[Papilio_machaon]
Location in the cell
Nuclear   Reliability : 3.663
 

Sequence

CDS
ATGTTCCTCACAGATTGTGATCTATGGGACTGTGTAAGTACAGACACACTTGATACTCCTGAATTAAAAAAGAGAGATAGTAAAGCAAGAGCAAAAATATGTCTACTCTTGGAAGAAAACATTTTCCCAATTGTTACCGGTGCCGTAACGGCAAAACAAACATGGGATGCGTTAGAAAAGGCCTACGCCGATGGCGGACTGCTAAGACGACTCACTTTATTAAGAAAATTATTTAATTTGAAATTATCATGTTTCGCAAATATCGAAGCATACATCAATGAAGTGCAGGCGACAAGTCAGGCTTTACAGCGAATCAAATCAGGACTGGATGATGAATTCATTGGGATCATAATGTTAGCTGGGTTGACCGAGGAATACAATCCTTTGGTGATGGCGTTGGAACATTCTGGAAGGAAATTAACTTCAGAAGCGGTCATATCTGCTCTAATGAAGGAAGGACAGCGCAAGCAGCCGGCAGTTGAAATGGATTCTGTGTTAGTGTCTAATAACGAAAAACCTAGTAGTAGTGCGAAAAAGGCAATAATATGTCATTTTTGTAAAAAGAAAGGTCATTTTAAATGGCAATGTAAATTTTATAAAGATAGGGATAAGAAAGGTAATGCAAATGTATGCGTAGCTCAAAATGAGACTAATGATTTTATTACCTTACTCTCTAGTATGAGAAAGTCGAGAAATTGGATTATAGATTCTGGGGCAACATCTCATATGACATCATCAGATAATGTTTTAGTAAATGCTAAAGGTGGTTACCGAAAGTATATAACTACAGCTAATAATGAGAAAATATTATCTAAGGTAAAGGGTGATGTATTGATGCCTAATTATAAGTTAAAATTTGAGAATGTTTTGTACATACCAGATTTGATAACCAATTTACTTTCTGTTAGTAGTATTTGTAAGCATGATTGTACAGTTGTTTTTGATAAACATTCTTGTAAAGTTTACAAATCTGGAGATGTATCCTTAGTGGGAAAAACTATTTTAGAAGCACCTTTAAAAGATGGGCTATATGTAGTAGACCGAGATGACAAGGCATTGGTTACTAAAGACATTAATTCGCCTGATAACGATCAATATAAGTTATGGCATAGGCGTTTAGGTCATTTATCACCAGCTCTAATGAATAAATTAAGAGGGTTAGTTGATGGCTTTACCTTGAATGAATTTAGTAAGGAACCATGCGTCAGTTGTTGTAAAGGTAAACAGTGCGTAAAAAAGTTCCCAAAAAGGAAGAATAAAAGAGCTAAGGATATATTGGAGTTGATTCACACGGACTTAGCTGGACCCATGGAGGAAGAGACATGGGGTGGTGCTCGATATTTTCTTATCTTTGTTGACGATTTTAGTCGGAAAGTTATGGGATATATGTTGAAATCCAAAACAGAAGTATTTGCTAAATTTAAGGAATTCAAGGTGTTTGTGGAGAATCAAACTAATAAAAAGATCAAAAAATTGCGTAGCGATAATGGTACTGAATATATAAACTATGAATTTCAAAGCTTTCTACGAGCTAATGGTATCCATCATCAGACTTCAGTGGCACACACTCCGCAACAAAATGGAGTGGCAGAGCGTACAATTCGTACTGTAATTGAAAAGGCACGTTGTATGTTGCAAGATAGTGGTTTGTCCAAAAAATTTTGGGGAGAAGCTGTGTTAACAGCTATGTATTTAAAAAATAGGTCTCCAACCATGGCTATCTCAGACAAAGTTCCTGAAGAAGTGTGGTCAGGTGAACGAGTGGATATCACCAATCTCAAGGTTTTTGGTAGTAAAGCTCAAGTACTCATTAAGGAAAACAATAGAAGGAAATTTGATTCAAAGTCAAGGGAACTAATTATGATTGGCTATAGTTTGAATCAAAAAGGCTATCGTTTCGTGGATATTAAGAATCCAACTCGGCTAATAATCGCTCGGGACGCAGTATTTTTTGAAAATGTTCAGAATTATGGAAAAGAAACCATTCATCTGGAGTATGTGGATAGTGCGCAGAGCAATGAGGTTTTAGTAAATAATAATTATCATTCGGTAATGCCTCAGGTTCCTGTACATATAGGAGATCCTGATGCAGTGGGGGAATTGGGAATGAATACTCCTGATCCAACCTCCTCTACAAATGATCCAAGCACCTCTACAAACGAACGTCGTTATTCAAAGAGGATTAGACGTCCCAAAATACAAGAAGATATGATCTATAATTTTTTGATTACCGAGGGATCAGATCCTAAGTCAGTTGAGGACGCATTGGAACGTTCGGATCGAGAGTTATGGCACACAGCCATGTTAGATGGATACAATTCGCTGATGCAAAACAAAAACAGTGAACAGAATTAA
Protein
MFLTDCDLWDCVSTDTLDTPELKKRDSKARAKICLLLEENIFPIVTGAVTAKQTWDALEKAYADGGLLRRLTLLRKLFNLKLSCFANIEAYINEVQATSQALQRIKSGLDDEFIGIIMLAGLTEEYNPLVMALEHSGRKLTSEAVISALMKEGQRKQPAVEMDSVLVSNNEKPSSSAKKAIICHFCKKKGHFKWQCKFYKDRDKKGNANVCVAQNETNDFITLLSSMRKSRNWIIDSGATSHMTSSDNVLVNAKGGYRKYITTANNEKILSKVKGDVLMPNYKLKFENVLYIPDLITNLLSVSSICKHDCTVVFDKHSCKVYKSGDVSLVGKTILEAPLKDGLYVVDRDDKALVTKDINSPDNDQYKLWHRRLGHLSPALMNKLRGLVDGFTLNEFSKEPCVSCCKGKQCVKKFPKRKNKRAKDILELIHTDLAGPMEEETWGGARYFLIFVDDFSRKVMGYMLKSKTEVFAKFKEFKVFVENQTNKKIKKLRSDNGTEYINYEFQSFLRANGIHHQTSVAHTPQQNGVAERTIRTVIEKARCMLQDSGLSKKFWGEAVLTAMYLKNRSPTMAISDKVPEEVWSGERVDITNLKVFGSKAQVLIKENNRRKFDSKSRELIMIGYSLNQKGYRFVDIKNPTRLIIARDAVFFENVQNYGKETIHLEYVDSAQSNEVLVNNNYHSVMPQVPVHIGDPDAVGELGMNTPDPTSSTNDPSTSTNERRYSKRIRRPKIQEDMIYNFLITEGSDPKSVEDALERSDRELWHTAMLDGYNSLMQNKNSEQN

Summary

EMBL
KQ460882    KPJ11482.1    LBMM01004924    KMQ91985.1    GBHO01011746    GBHO01011744    + More
GBHO01011742    JAG31858.1    JAG31860.1    JAG31862.1    KQ460297    KPJ16236.1    NWSH01000816    PCG74073.1    NWSH01002292    PCG68657.1    PCG68658.1    JYDJ01000808    KRX33413.1    KQ460208    KPJ16606.1    JYDR01000001    KRY80095.1    JYDS01000009    JYDV01000021    KRZ33483.1    KRZ41218.1    JYDT01000069    KRY86576.1    JYDJ01000136    KRX42725.1    AGBW02009826    OWR49812.1    GBHO01026221    JAG17383.1    JYDH01000330    KRY26802.1    KQ459875    KPJ19636.1    GEZM01045162    JAV77889.1    NEVH01019375    PNF22597.1    NEVH01002725    PNF41351.1    NEVH01006980    PNF36330.1    KL367628    KFD61291.1    GAKP01015352    JAC43600.1    NEVH01006721    PNF37230.1    GEHC01000991    JAV46654.1    KL367553    KFD64618.1    GFTR01008662    JAW07764.1    GEZM01011856    JAV93393.1    GEZM01011858    GEZM01011854    JAV93389.1    GEHC01000990    JAV46655.1    GANO01000510    JAB59361.1    GBXI01011094    JAD03198.1    GEZM01011857    JAV93390.1    JYDK01000071    KRX78146.1    GALX01001351    JAB67115.1    JYDQ01000379    KRY07987.1    LBMM01017716    KMQ83988.1    KRX78123.1    GANO01000659    JAB59212.1    GANO01000660    JAB59211.1    GBHO01003630    JAG39974.1    GDHC01012180    JAQ06449.1    LVZM01023578    OUC39908.1    GEHC01000988    JAV46657.1    GEHC01000989    JAV46656.1    GEZM01013472    GEZM01013471    GEZM01013470    JAV92539.1    GBHO01036544    JAG07060.1    JXUM01099713    KQ564513    KXJ72145.1    JYDL01000297    KRX12674.1    GEHC01000868    JAV46777.1    GEDC01002834    JAS34464.1    JYDU01000001    KRY01876.1    GEHC01000867    JAV46778.1    GBHO01020706    JAG22898.1    JYDP01000032    KRZ13440.1    JYDJ01000877    KRX33198.1    GEZM01045163    JAV77888.1    GBHO01033237    JAG10367.1    GDHF01030254    JAI22060.1    GBHO01033235    JAG10369.1    JXUM01077078    KQ562985    KXJ74708.1    GBXI01002679    JAD11613.1    GAMC01020736    JAB85819.1    GEHC01000965    JAV46680.1    DS566470    GBHO01026200    JAG17404.1    GAMC01018157    JAB88398.1    GAMC01018154    JAB88401.1    OIVN01001906    SPC98838.1    GAMC01018156    JAB88399.1    OIVN01000332    SPC78433.1    OIVN01000486    SPC81000.1    OIVN01003986    SPD14739.1    OIVN01006217    SPD28032.1    LBMM01008124    KMQ89126.1    ASHM01027010    PNX74094.1    OIVN01000260    SPC77257.1    GAMC01020735    JAB85820.1    GBXI01016677    JAC97614.1    JXUM01155181    KQ572138    KXJ68075.1    OIVN01006466    SPD33659.1    KQ483843    KYP40338.1    JYDU01000039    KRX96809.1    OIVN01006353    SPD31284.1    OIVN01002424    OIVN01005946    SPD03496.1    SPD24589.1    GEHC01000927    JAV46718.1    OIVN01001931    SPC99063.1    GDUN01000214    JAN95705.1    LBMM01012669    KMQ86061.1    D83003    BAA11674.1    GBXI01000292    JAD14000.1    GDUN01000217    JAN95702.1    GDUN01000215    JAN95704.1    KYP40337.1   
Pfam
PF13976   gag_pre-integrs        + More
PF00665   rve
PF13961   DUF4219
PF07727   RVT_2
PF00098   zf-CCHC
PF00078   RVT_1
PF13696   zf-CCHC_2
Interpro
IPR036875   Znf_CCHC_sf        + More
IPR012337   RNaseH-like_sf       
IPR001878   Znf_CCHC       
IPR013103   RVT_2       
IPR001584   Integrase_cat-core       
IPR039537   Retrotran_Ty1/copia-like       
IPR025314   DUF4219       
IPR025724   GAG-pre-integrase_dom       
IPR036397   RNaseH_sf       
IPR000477   RT_dom       
IPR025829   Zn_knuckle_CX2CX3GHX4C       
SUPFAM
SSF53098   SSF53098        + More
SSF57756   SSF57756       
Gene 3D
PDB
3O4Q     E-value=0.0234269,     Score=91

Ontologies

Topology

Length:
784
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.03728
Exp number, first 60 AAs:
0.03227
Total prob of N-in:
0.00191
outside
1  -  784
 
 

Population Genetic Test Statistics

Pi
159.845979
Theta
159.54292
Tajima's D
0.027561
CLR
0.091874
CSRT
0.379681015949203
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号