SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10341
Pre Gene Modal
BGIBMGA007228
Annotation
putative_amino_acid_transporter_[Bombyx_mori]
Full name
Transporter       + More
Sodium-dependent nutrient amino acid transporter 1      
Location in the cell
PlasmaMembrane   Reliability : 4.861
 

Sequence

CDS
ATGGATTCAAATGGGATAAATGAAAAGGGGGATCGGGTGAACGCGGGATTTGATCCATCGCCAGAAAATGTTAATGATTTAAAGGCTATCGACAACGAAGATGGGAAGAAAAGAAACGTGGCTGAGCGCCCAACATGGGACAATCAAATCGAGTTTCTTATGTCTTGCATCGCCACATCGGTTGGTCTCGGAAACGTATGGCGGTTTCCTTTCGTCGCCTACCAAAACGGCGGTGGAGCCTTCCTAATTCCATACATAATAGTACTTTTAGTCATAGGCAAACCTATGTACTTCCTCGAAACAGTACTCGGGCAGTTTAGCAGCGGGAACTGCGTCAAGATCTGGGCATTGTCTCCGGCTATGACCGGTACTGGATACGCACAGACCTTGGGGGCCGTCTACGTGCTTTCGTACTACGTATCAATCATCGCCCTTTGCCTTTACTACTTCGGAGTGAGCTTTAACGCGACCTTACCTTGGACACAATGCCTACCCGAGTGGAGGAACTGTGTGCCTTCAGGACAATCCGCAAATCTTACTGAAATACAAGGTGAAGCCGTCAGTAGCGCCCAACTATACTTCACGGAGACGGTTTTACGTCAATCCGACAGAATAGATGATGGAATCGGAATTCCGATATGGGATCTCACTTTGTGTCTGCTGGTATCGTGGCTTATAATTTTTGTCATCGTGGCCAGAGGTGTGAAGAGTTCTGGCAAGGCTGCTTATTTTCTCGCTCTCTTCCCATACGTAGTTATGTTTATTTTATTGATTAGGGCTGTGACCTTACCAGGTGCCGGTAATGGAATCCTGTTTTTCATTACGCCTCAATGGTCAAAAATCCTTGAAGTCAGGGTAAGAAAATACTTCAAATTTTACACAGACCTTGTTCTTTTAATTGAATTTTTTAATGTTAATCATTTATTTAATCGTTACAACTTAAGGTACAACAAGGAAAGATAG
Protein
MDSNGINEKGDRVNAGFDPSPENVNDLKAIDNEDGKKRNVAERPTWDNQIEFLMSCIATSVGLGNVWRFPFVAYQNGGGAFLIPYIIVLLVIGKPMYFLETVLGQFSSGNCVKIWALSPAMTGTGYAQTLGAVYVLSYYVSIIALCLYYFGVSFNATLPWTQCLPEWRNCVPSGQSANLTEIQGEAVSSAQLYFTETVLRQSDRIDDGIGIPIWDLTLCLLVSWLIIFVIVARGVKSSGKAAYFLALFPYVVMFILLIRAVTLPGAGNGILFFITPQWSKILEVRVRKYFKFYTDLVLLIEFFNVNHLFNRYNLRYNKER

Summary

Description
Unusual broad substrate spectrum amino acid:sodium cotransporter that promotes absorption of the D isomers of essential amino acids. Neutral amino acids are the preferred substrates, especially methionine and phenylalanine (By similarity).
Unusual broad substrate spectrum amino acid:sodium cotransporter that promotes absorption of the D isomers of essential amino acids. Neutral amino acids are the preferred substrates, especially methionine and phenylalanine.
Similarity
Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family.
Keywords
Amino-acid transport   Complete proteome   Glycoprotein   Ion transport   Membrane   Reference proteome   Sodium   Sodium transport   Symport   Transmembrane   Transmembrane helix   Transport  
Feature
chain  Sodium-dependent nutrient amino acid transporter 1
EMBL
AB365597    BAG39453.1    BABH01039076    BABH01039077    BABH01039078    BABH01039079    + More
AGBW02014242    OWR42034.1    NWSH01000921    PCG73535.1    PCG73534.1    RSAL01000036    RVE51256.1    ODYU01004070    SOQ43562.1    KQ459232    KPJ02811.1    PCG73533.1    KQ461155    KPJ08125.1    GDQN01006688    JAT84366.1    GDQN01010095    JAT80959.1    GDQN01004191    GDQN01000328    JAT86863.1    JAT90726.1    GDQN01011140    JAT79914.1    NWSH01000569    PCG75591.1    SOQ43560.1    AF013963    AAF18560.1    AF006063    AAC24190.1    PCG73532.1    PCG73531.1    AJVK01003076    AJVK01003077    AJVK01003078    JXJN01008983    KQ763581    OAD54951.1    JXUM01095215    JXUM01095216    JXUM01095217    JXUM01095218    KQ564180    KXJ72615.1    DS235282    EEB14370.1    GBXI01000417    JAD13875.1    NEVH01024531    PNF16994.1    KQ414608    KOC69394.1    LRGB01000781    KZS15997.1    QOIP01000004    RLU23635.1    OAD54950.1    AJWK01024833    AJWK01024834    GDHF01016852    JAI35462.1    GDIP01059887    JAM43828.1    CH933814    EDW05515.1    NNAY01001443    OXU23962.1    QOIP01000006    RLU21298.1    PNF16938.1    GDIP01238958    JAI84443.1    KZ288308    PBC28722.1    ADTU01020082    ADTU01020083    ADTU01020084    ADTU01020085    ADTU01020086    ADTU01020087    ADTU01020088    ADTU01020089    ADTU01020090    ADTU01020091    CH964239    EDW81840.1    OUUW01000003    SPP78406.1    AY330296    AAR08269.1    CM000071    EAL26168.3    CH477509    EJY57747.1    CH479193    EDW26724.1    CCAG010020761    GANO01002161    JAB57710.1    CH479183    EDW35549.1    AY071318    AAL48940.1    KRT02897.1    GDIQ01124476    JAL27250.1    CM000162    EDX01121.1    GFDL01000068    JAV34977.1    CH379064    EAL32192.1    EAT39788.1    CH902622    EDV34476.1    GDIQ01156251    JAK95474.1    GBYB01015246    JAG85013.1    GL448301    EFN84817.1    CH954180    EDV45889.1    BT099637    ACU68946.1    DQ073009    AE014298    AY121662    AAF46031.2    AAM51989.1    AF543193    AAN40410.1    GDIQ01253497    JAJ98227.1    GL450241    EFN81283.1    CM000366    EDX17133.1    GDIP01123271    JAL80443.1    CVRI01000070    CRL07420.1    CH963849    EDW74394.1    GDIP01167429    JAJ55973.1    GFDF01007368    JAV06716.1    GDIQ01053859    JAN40878.1    GDIQ01007327    JAN87410.1    GDIP01238678    JAI84723.1    GDIQ01122189    JAL29537.1    GDIQ01168559    JAK83166.1    GFDF01007367    JAV06717.1    GDIQ01170422    JAK81303.1    KK852489    KDR22766.1    GL763991    EFZ18898.1    GDIQ01093536    JAL58190.1    GDIP01068181    JAM35534.1    GDIQ01268049    GDIQ01141708    JAL10018.1    GDIQ01165667    GDIQ01165666    JAK86059.1    DS232189    EDS37047.1    GDIQ01031762    JAN62975.1    GDIP01119086    JAL84628.1   
Pfam
PF00209   SNF        + More
PF00246   Peptidase_M14
PF01423   LSM
Interpro
IPR037272   SNS_sf        + More
IPR000175   Na/ntran_symport       
IPR000834   Peptidase_M14       
IPR010920   LSM_dom_sf       
IPR034100   Sm_F       
IPR001163   LSM_dom_euk/arc       
SUPFAM
SSF161070   SSF161070        + More
SSF50182   SSF50182       
PDB
6DZZ     E-value=8.02488e-53,     Score=522

Ontologies

Topology

Subcellular location
Membrane  
Length:
320
Number of predicted TMHs:
5
Exp number of AAs in TMHs:
111.20085
Exp number, first 60 AAs:
2.27447
Total prob of N-in:
0.24294
outside
1  -  70
TMhelix
71  -  93
inside
94  -  129
TMhelix
130  -  152
outside
153  -  209
TMhelix
210  -  232
inside
233  -  240
TMhelix
241  -  263
outside
264  -  291
TMhelix
292  -  309
inside
310  -  320
 
 

Population Genetic Test Statistics

Pi
191.656933
Theta
162.431584
Tajima's D
0.366903
CLR
100.679869
CSRT
0.470176491175441
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号