SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10321
Annotation
PREDICTED:_uncharacterized_protein_LOC106713896?_partial_[Papilio_machaon]
Location in the cell
Mitochondrial   Reliability : 2.159
 

Sequence

CDS
ATGCATCATCCACGTTCGTCTGTAATGAGGTTGTATATTCCTCGGAACTGTGGGGGTCGTGGTATTTTGAATGCCAAGGATCTACATAACCGAGAGATATACAACCTTAGGGAATATTTCCTTAAGATGAATGTGAATATGTATCGGGATGTCGTTGCAGTCGATAAGGGGCTAACTCCGCTATCCTTAGCTAACGGGAATTGGAAGAGGCTGAAGGTAGAGAGTATTTCAGATCGCATAACTGTATGGAGGAGCAAGGAGTTACACGGTAGGTTCTACCGGGCTCTCACAGGGCCTGATGTAGACCAATTAGCTTCCGTGGCCTGGTTACGATTCAGTAACCTCTTTGGGGAAACTGAAGGTTTTATCTTTGCAATTATGGACGAAGTTATCATGACGAACAACTACCGGAAATATATACTAAAGGATGGGACGGTCGACATTTGTCGGGCATGCCACCGTCCGGGAGAGTCTATTAGACATATTGTTTCTGGCTGTTCTCGGTTTGCTAACGGCGAGTACTTGCATAGACATAACCAAGTGGCTAGGATTATCCATCAACAACTTGCTCTGAAATATGGTTTTCTTGATTCTGCTGTACCTTATTACCAATACCAACCTCAACCAGTTCTTGATAATGGTCATGTTACGCTCTACTGGGACCGATCTATTATCACGGATAGGTATATTATTGCCAATAAACCTGATATTGTGATAATAGATCGATCTGCGCGTCGAGCAGTGTTGGTTGATGTCACCATTCCTCATGACGAGAACCTCGTGAAGGCAGAAAAGGACAAATTAATAAAATATTTAGACCTGGCCCACGAGACTACCGCCATGTGGCATGTTGATTCAACCATCATTGTTCCAATAGTTGTATCGGTACACGGCTTGATAGCGAAAAGTTTCGATCAACATCTTAAGAAACTTTCGTTATCCAGCTGGGTTAAGGGCCTAATACAGAAAGCAGTTATCCTCGATACTGCACGCATTGTGAGGAGGTTTCTCACTCTGGAGTCCTAA
Protein
MHHPRSSVMRLYIPRNCGGRGILNAKDLHNREIYNLREYFLKMNVNMYRDVVAVDKGLTPLSLANGNWKRLKVESISDRITVWRSKELHGRFYRALTGPDVDQLASVAWLRFSNLFGETEGFIFAIMDEVIMTNNYRKYILKDGTVDICRACHRPGESIRHIVSGCSRFANGEYLHRHNQVARIIHQQLALKYGFLDSAVPYYQYQPQPVLDNGHVTLYWDRSIITDRYIIANKPDIVIIDRSARRAVLVDVTIPHDENLVKAEKDKLIKYLDLAHETTAMWHVDSTIIVPIVVSVHGLIAKSFDQHLKKLSLSSWVKGLIQKAVILDTARIVRRFLTLES

Summary

Pfam
PF00078   RVT_1
Interpro
IPR000477   RT_dom        + More
IPR001611   Leu-rich_rpt       

Ontologies

Topology

Length:
341
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
3.22896
Exp number, first 60 AAs:
0.00043
Total prob of N-in:
0.03837
outside
1  -  341
 
 

Population Genetic Test Statistics

Pi
213.357237
Theta
38.320354
Tajima's D
1.636715
CLR
0.019498
CSRT
0.821308934553272
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号