SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10289
Pre Gene Modal
BGIBMGA007296
Annotation
transposase_[Chilo_suppressalis]
Location in the cell
Nuclear   Reliability : 2.939
 

Sequence

CDS
ATGTCTAAGCGGTTGGCAGAGCAAGATATTGAAAATATTTTATCAGTTCTCGAAAATGGAGACATTTCTGAAGATGAAGAGTCTATAGGAGACGAAAATGACATAGATTACTACTCGAATGTACAAGATCTGATACAGGATTTAGAAGATGCAGAAGAAGATCAGTATAATGCAAATCCTGATGTACCTATTGAAGAAGACCATCTACCGGATGAGTTTTCAGTTCCAGGGCCTTCACTTAGTCGCCCACTATCAGGTGTCATTGGTGCAGCAGCCTTGAGGCAACGAAGTAGGCAACTTATATGGAAAAAAGGCAATTTGGAATTTAGTGAAGACCGCATAAGTTTTACAGGTAATATAGACCTTTCCCCAGAATTTGCCCAACTAGAAACACCATTTCAGTATTTTACGCTATTTTTAAACGATGATATATTAGTAAAAATCGTGAATGAGACCAATTTGTATATCACGCAAAAAGGCATCTCCAACTGCCCTCCTGTAAATGTCAAGGAAATTCGTCAGTTTCTTGGTATTATTATATTTATGTCAGTATATCACTTCCCAAATGTAAGATCATATTGGGGTAAGTATGGCTTCAAACATATAATGGAAACGATGACGCTAAATAGATTTGGAAAACTACGATCCGTCATTCACTTCAATGACAACTCATTACACAAGCCCGTTGGTCACCCAAACCACGACCGTCTGCATAAAATAAGACCTGTAGAGGCACATTTGAATAAATTATTTTTGAGTGTGGCACCATTTGAGCAGAGACTGTCCTTAGATGAACAGATGTGCTCTACGAAAGTAGCGCATTTCATGAAACAATACCTCCCCAACAAGCCCCATAAGTGGGGTTTCAAGCTATACGTTCTGTGCTCATTGTCTGGTTACGCTCACAACTTTGAAATTTATTCTGGAAAACAGAATATTCAATACTCAAGTGATGAACCTGATCTTGGTGTAGTAGGCAACACAGTCATCAGATTGTGCCGTTCAGTTCCACGAAGAATGAACCACATAATTTATTTTGATAATTTTTATTCGTCAATTCCTTTGTTATATTACCTACATACTCAAGGTATATATGCATTGGGCACAATTCAGAGGAACCGACTCGGTAAAACCTGTAAGTTGCCGGTAGTAAAAGAGTTTATGAAGGACTCTGTTCCAAGGGGATCATATGAGGAACTCGTAGCAGACTATGAAGGTGTGGATATCTCGGTAACTTGTTGGAAGGATAATAAGCTTGTTACGTTGGTATCTACTTATGTTGGTTCCGAACCGGCTGAAACTGTCAGCAGATTTGATAAGAAACAAAAGAAAAAAGTCTCTGTTGCCTGTCCAAAAATTGTAAAAGATTACAATGCCCACATGGGTGGAGTAGATTTGATGGACAGTAGCGACATCTGTCGAAAGAGCATGCGGAACTTCGATTAA
Protein
MSKRLAEQDIENILSVLENGDISEDEESIGDENDIDYYSNVQDLIQDLEDAEEDQYNANPDVPIEEDHLPDEFSVPGPSLSRPLSGVIGAAALRQRSRQLIWKKGNLEFSEDRISFTGNIDLSPEFAQLETPFQYFTLFLNDDILVKIVNETNLYITQKGISNCPPVNVKEIRQFLGIIIFMSVYHFPNVRSYWGKYGFKHIMETMTLNRFGKLRSVIHFNDNSLHKPVGHPNHDRLHKIRPVEAHLNKLFLSVAPFEQRLSLDEQMCSTKVAHFMKQYLPNKPHKWGFKLYVLCSLSGYAHNFEIYSGKQNIQYSSDEPDLGVVGNTVIRLCRSVPRRMNHIIYFDNFYSSIPLLYYLHTQGIYALGTIQRNRLGKTCKLPVVKEFMKDSVPRGSYEELVADYEGVDISVTCWKDNKLVTLVSTYVGSEPAETVSRFDKKQKKKVSVACPKIVKDYNAHMGGVDLMDSSDICRKSMRNFD

Summary

Pfam
PF13843   DDE_Tnp_1_7        + More
PF06371   Drf_GBD
PF02181   FH2
PF06367   Drf_FH3
PF00047   ig
Interpro
IPR029526   PGBD        + More
IPR042201   FH2_Formin_sf       
IPR010472   FH3_dom       
IPR015425   FH2_Formin       
IPR011989   ARM-like       
IPR014767   DAD_dom       
IPR016024   ARM-type_fold       
IPR010473   GTPase-bd       
IPR014768   GBD/FH3_dom       
IPR003598   Ig_sub2       
IPR036179   Ig-like_dom_sf       
IPR007110   Ig-like_dom       
IPR003599   Ig_sub       
IPR013783   Ig-like_fold       
IPR013151   Immunoglobulin       
SUPFAM
SSF48371   SSF48371        + More
SSF48726   SSF48726       
Gene 3D

Ontologies

Topology

Length:
481
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
3.26363
Exp number, first 60 AAs:
0
Total prob of N-in:
0.05190
outside
1  -  481
 
 

Population Genetic Test Statistics

Pi
52.048112
Theta
15.838772
Tajima's D
-1.181131
CLR
110.31661
CSRT
0.106044697765112
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号