SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10241  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA012651
Annotation
PREDICTED:_uncharacterized_protein_LOC106139693_isoform_X1_[Amyelois_transitella]
Location in the cell
Mitochondrial   Reliability : 2.088
 

Sequence

CDS
ATGTCTTTGAAGAATAGGTTAATTGCATGTCTGCAAAAACTGAAGGAATACGATTACACTGACGTAGACAAGGCAAGAGCTAGTGACGCGAAGGCCGAGAATGCCCTCAACTTAATATACCAGACTGCTTTAAAGAAAACAACTTTTACACCAGAAGAGAAGAAAATTGTAGGTTCTCTTTTATTTGATGCCATCACACCGATACAAAGCAACATAGAAGGAACGCTCTGCGAATACAGAACTAGATTAGATACCTCTGTGCTTATGAAAAGATCTGCAATACAATTCTTGATTGACGAATACGGGAAGTTTCCAGTTGAGAATTCTATCTTGGCTACAAAGTTAGAGGAAGCCGGCATAGCAGAGAGCGTTGAAATACTCAATGAAATTATAAATAGGACATCGGCGGTCCTAGCAGGAGGAGCAGTTGGATGCCTCGCAGGACCGGCAGGAGCCGCATTGGGAGGAGTATACGGAGGCATGATTACAGACGGCTTGGTTTCTGCGGCTAAGAACGAGCCTGTAGGTATTTTTGAGTCAAGTGCAAATATAGGTAGAGACATTGCTTCAGGCAAAAATCCAATGGCTTCTGTGGGTTCCGCAAGTTTCAAAATCGCCATGGACGGTATAGGTGGCTTTGGCATGGGAGGAGTTTCTAGCGTTGCCAGTAAAGTCCCGGCGAAGGCCGTCGCAAAAACCATAGAAGGCACTGTAAAAAAAGCTGCTGCAACTATTGGGGAGGAGATGATTGAGAAGTCAGTGCAATTAACTGCAGAAGAAATGACAAAAATTGTGGCAAAGAAAGTGTCAGAAAAAGCCGTGAAAAAAGCTGTCGAAACTGCAGCAATACAAACACAAATGCTTCTGGTGTCTGCTCACGTCGGAGTAAATGCTAGTGAAAAAACCAAAGCTGAAACGCGTGCTGAAGAAGAACGTAAACAACAGAAACAAAAAGAAGAAGAAAAAAAGGCGCGTGAAAATCGCGATAAAAAAAATACTGGATCGTGGCAACCGCCACGCGAGAACAGAAACAATAAAGAGTCCAATGTTGATAATGAAGAGTCCGACGAGGAGTTGTATTTTATGACCAAAACCAAAGGTAAACCGACTCGTCAATCAGATGCCGACCGAAATGAGCGTCGAAGGAACGCCATCAGAGAACTTCAAAACAAAAGGGATATAATTCAGAAAATTGCTGATCTATTCAGACATTTACAAGCGGAAATCATAGCTGAAACGAGCGCGCCTAATATAATTTCCCCCTATTTTCGTGATATATTCTCAGCTGTGTATCATTATTACAAACACAGACGCGTGCCCGTGCCAGGCCATGAGAAGCTGACAGTCAAACAATATTTCGACTTGATAAGGATGGTAATTATAAAAATGAAAGAATCACCGGAATACAAAAAAATGCAGAAGGCCAGAAATGGAACGGCCCTCACTTGTGAAATGTACGTGGTCTTGTTCGGTAGGATGTTCAGAATTATTATTACTGTTCGAGATGGTGAAATTGTATTGAGTACCGCCTATGTAGTCAAGCGTATGAACTTTAATGCCAAAGAAGGCATTCTTTACATAAAATTCGGTGATGGAGATGTACAGAAGTAA
Protein
MSLKNRLIACLQKLKEYDYTDVDKARASDAKAENALNLIYQTALKKTTFTPEEKKIVGSLLFDAITPIQSNIEGTLCEYRTRLDTSVLMKRSAIQFLIDEYGKFPVENSILATKLEEAGIAESVEILNEIINRTSAVLAGGAVGCLAGPAGAALGGVYGGMITDGLVSAAKNEPVGIFESSANIGRDIASGKNPMASVGSASFKIAMDGIGGFGMGGVSSVASKVPAKAVAKTIEGTVKKAAATIGEEMIEKSVQLTAEEMTKIVAKKVSEKAVKKAVETAAIQTQMLLVSAHVGVNASEKTKAETRAEEERKQQKQKEEEKKARENRDKKNTGSWQPPRENRNNKESNVDNEESDEELYFMTKTKGKPTRQSDADRNERRRNAIRELQNKRDIIQKIADLFRHLQAEIIAETSAPNIISPYFRDIFSAVYHYYKHRRVPVPGHEKLTVKQYFDLIRMVIIKMKESPEYKKMQKARNGTALTCEMYVVLFGRMFRIIITVRDGEIVLSTAYVVKRMNFNAKEGILYIKFGDGDVQK

Summary

Uniprot
ProteinModelPortal

Ontologies

GO

Topology

Length:
536
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
11.77963
Exp number, first 60 AAs:
0.00025
Total prob of N-in:
0.48524
outside
1  -  536
 
 

Population Genetic Test Statistics

Pi
332.32171
Theta
182.541204
Tajima's D
2.691911
CLR
0.512259
CSRT
0.95965201739913
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
31250652 AKIIITFQRYYVNDSFYDFKNQGPVFLMIGGEGPADARWMVTGTWINYAKKFNALCINLEHRFYGESHPTL 96.63 1e-123
31250652 AKIIITFQRYYVNDSFYDFKNQGPVFLMIGGEGPADARWMVTGTWINYAKKFNALCINLEHRFYGESHPTL 98.91 4e-61
28556443 SAIQFLIDEYGK 100.00 2e-09
28556443 EYDYTDVDK 100.00 1e-05
26280517 NDPVVITDFHDGPGWK 100.00 6e-04
28556443 IAMDGIGGFGMGGVSSVASK 100.00 6e-04
28556443 IAMDGIGGFGMGGVSSVASK 100.00 6e-04
28556443 LDTSVLMK 100.00 0.009
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号