SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10224
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.432
 

Sequence

CDS
ATGACCGTACAAATCCAGGATTGCCAGTCTAGACCTATCAAGCTGCAGCGGGGTGTCCGACAGGGAGATGTTATATCTCCGAAACTGTTCACCGCTGCACTTGAAGATGTCTTCAAGACGCTGGACTGGAAAACATGTAGAATCAACGTCAACGGAGAGTACATGTCACACCTTCGATTTGCCGATGACATAGTCTTAATATCGGAATCGCTGGAGGACCTCCGTCGTATGCTCAACGATCTCAATGCTGCTTCCCGATGCGTGGGACTGCGCATGAACCTTGACAAGACGAAAGTCATGTTCGATGATAAAATCGTCCCGGGCCAAGTTACCATCTCGAATGCAGTCGTTGAAGAGGTAAAAGACTTTGTCTACCTCGGTCAGGCTATCCAGCTTGACCGGGGTAACTTCAATACAGAGATTGAGAGACGCATACGACTGGGTTGGTCGGCATTTGGGAAATTCCGTGCAATCCTCACCTCGCAAATTCCTCAATGCCTGAAGAAAAAAGTATTTAACCATTCGCGCGTTCTCCCCGCGATGACCTATGGCACGGAAACCTGGACACTCACGGCAGGGCTGGCCCATAAGTTAAGAGTCGCACAGCGGGCGATGAAGAGAGCTAGGCTCGGTATTTCTCTAAGAGACAAAATCCGGAACGAAGAAATTCGACGGAGAACCAAAGTCGACGACATAGCTCTCAAAGTTAGCAGGCTGAAGTGGCAATGGGCCGGTCACATCTGTCGAGCCAGCGACGTCAGGTGGGGGAGGAAAGTCCTCGAATGGAGGCCACGGATGGGTACCAGGAGCGTGGGGCGTCCTCCAACCAGGTGGACTGACGACTTAGTGCGCACGGCGGGAAGTCGTTGGATGCGGAAGGCGGAGGACCGCATTATGTGGAAGGCATTGGGGAAGGCCTATGTCCAGCAGTAG
Protein
MTVQIQDCQSRPIKLQRGVRQGDVISPKLFTAALEDVFKTLDWKTCRINVNGEYMSHLRFADDIVLISESLEDLRRMLNDLNAASRCVGLRMNLDKTKVMFDDKIVPGQVTISNAVVEEVKDFVYLGQAIQLDRGNFNTEIERRIRLGWSAFGKFRAILTSQIPQCLKKKVFNHSRVLPAMTYGTETWTLTAGLAHKLRVAQRAMKRARLGISLRDKIRNEEIRRRTKVDDIALKVSRLKWQWAGHICRASDVRWGRKVLEWRPRMGTRSVGRPPTRWTDDLVRTAGSRWMRKAEDRIMWKALGKAYVQQ

Summary

Similarity
Belongs to the ATP-dependent DNA ligase family.
EMBL
FJ265545    ADI61813.1    FJ265551    ADI61819.1    FJ265542    ADI61810.1    + More
EF113399    EF113400    ABO45233.1    EF113398    EF113401    ABO45231.1    FJ265549    ADI61817.1    EF113402    ABO45239.1    RSAL01002362    RVE40503.1    FJ265550    ADI61818.1    FJ265544    ADI61812.1    FJ265543    ADI61811.1    RSAL01002130    RVE40575.1    KZ150072    PZC74016.1    AAGJ04144474    RSAL01000007    RVE54059.1    KZ149985    PZC75698.1    RSAL01000016    RVE53061.1    GFAC01005640    JAT93548.1    MRZV01002136    PIK34564.1    KZ150317    PZC71439.1    MRZV01000899    PIK42833.1    KZ150485    PZC70710.1    AAGJ04050748    GBBI01004876    JAC13836.1    MRZV01000640    PIK46507.1    FJ265561    ADI61829.1    ODYU01004982    SOQ45402.1    FJ265563    ADI61831.1    KZ149912    PZC78089.1    FJ265562    ADI61830.1    KZ150108    PZC73382.1    JARK01001655    EYB84321.1    JARK01001372    EYC15592.1    JARK01001389    EYC11015.1    JARK01001639    EYB85201.1    JARK01001351    EYC23394.1    JARK01001370    EYC16151.1    JARK01001677    EYB83167.1    EYB83168.1    JARK01001396    EYC09581.1    FJ265564    ADI61832.1    EYC23395.1    JARK01000807    EYC34984.1    JARK01000732    EYC35149.1    JARK01001340    EYC31295.1    JARK01001512    EYB94036.1    JARK01001565    EYB89683.1    UYWY01019694    VDM38828.1    JARK01001348    EYC25145.1    JARK01001676    JARK01001446    JARK01001433    EYB83199.1    EYC01126.1    EYC02928.1    JARK01001337    EYC34625.1    JARK01000173    EYC41342.1    JARK01001341    EYC30284.1    GBBM01001358    JAC34060.1    JARK01001434    EYC02684.1    JARK01000388    EYC37469.1    EYC16150.1    JARK01001362    EYC18843.1    EYC18844.1    JARK01001343    EYC28837.1    CAVP010058791    CDL95187.1    JARK01001486    EYB96452.1    EYC25048.1    JARK01001736    JARK01001462    JARK01001379    JARK01001338    EYB80775.1    EYB98943.1    EYC13646.1    EYC33347.1    JARK01000347    EYC38051.1    EYC25050.1    JARK01000460    EYC36749.1    EYC25046.1    JARK01001543    EYB91354.1    JARK01001621    EYB86109.1    EYC25049.1    EYB91355.1    JARK01001674    EYB83299.1    EYB83300.1    JARK01001626    EYB85833.1    JARK01001473    EYB97806.1    JARK01001354    EYC21986.1    JARK01001711    EYB81734.1    EYC30828.1    JARK01000055    EYC44622.1    GBGD01000453    JAC88436.1    JARK01001464    EYB98786.1    EYC44623.1    JARK01001568    EYB89432.1    EYB91353.1    JARK01001730    EYB81048.1    JARK01001500    EYB95040.1    EYC28825.1    JARK01001700    JARK01001393    EYB82228.1    EYC10181.1    ODYU01008249    SOQ51673.1    JARK01001518    EYB93419.1    GBBI01004877    JAC13835.1    CAVP010058300    CDL94394.1    GDKW01001596    JAI54999.1    EYB91356.1    JARK01001349    EYC24583.1   
Pfam
PF14529   Exo_endo_phos_2        + More
PF00078   RVT_1
PF01826   TIL
PF11411   DNA_ligase_IV
PF04675   DNA_ligase_A_N
PF04679   DNA_ligase_A_C
PF01068   DNA_ligase_A_M
PF13855   LRR_8
PF10323   7TM_GPCR_Srv
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR036084   Ser_inhib-like_sf       
IPR002919   TIL_dom       
IPR001357   BRCT_dom       
IPR036420   BRCT_dom_sf       
IPR012340   NA-bd_OB-fold       
IPR016059   DNA_ligase_ATP-dep_CS       
IPR012310   DNA_ligase_ATP-dep_cent       
IPR021536   DNA_ligase_IV_dom       
IPR029710   LIG4       
IPR000977   DNA_ligase_ATP-dep       
IPR012308   DNA_ligase_ATP-dep_N       
IPR036599   DNA_ligase_N_sf       
IPR012309   DNA_ligase_ATP-dep_C       
IPR032675   LRR_dom_sf       
IPR001611   Leu-rich_rpt       
IPR003591   Leu-rich_rpt_typical-subtyp       
IPR029052   Metallo-depent_PP-like       
IPR019426   7TM_GPCR_serpentine_rcpt_Srv       
SUPFAM
SSF56219   SSF56219        + More
SSF57567   SSF57567       
SSF52113   SSF52113       
SSF50249   SSF50249       

Ontologies

Topology

Length:
310
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.10676
Exp number, first 60 AAs:
0.00024
Total prob of N-in:
0.08262
outside
1  -  310
 
 

Population Genetic Test Statistics

Pi
76.276185
Theta
116.159968
Tajima's D
-0.949969
CLR
412.992998
CSRT
0.146742662866857
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号