SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10192
Annotation
pol_polyprotein_[Lasius_niger]
Full name
Galactose-1-phosphate uridylyltransferase      
Location in the cell
Nuclear   Reliability : 2.592
 

Sequence

CDS
ATGAGCTTTGGTCTTTGCAACGCAGCTCAAACATTTCAACGCTTCATGGATGAAATCTTGAGAGACCTTGACTTTTGTTATCCTTATATCGATGATATTTTAATAGGGAGCCAGAACGAGACATTGCACCTGGAACATCTGAAGAAAGTATTTCAACGTCTCCAGGACCACGGCGTTGTTATTAATGTTTCGAAATGCGTGTTTGGTGAGCCCCAGGTAGATTTTTTAGGCTACGCCGTATCATCTTCGGGCACCAGACCGCTTCTTCAGAAAGTGGAGGCGATCCAGAACTTCCCGCAGCCGAAAACTATTAAAGAATTACGAAGATTTCTGGGTATGGTTAATTTCTATAGACGTTTCATGCCTAAAGCTGCAAATATCCAAGCTCCGCTCCATAATGTTTTATCCGGCCCAGCTTTAAAACCCCGTACGCCTATTACCTGGTCAGCTGACCTGCTGGAAGCCTTTATCGCTTGTAAGAAAAGTTTAGCTGAAGCGACATTGCTAGCTCATCCTAACCCATCGGCAGCTTTGATACTCTGTACGGATGCTTCTGATAATGCAATCGGTGCCGTACTACAGCAAAAGACAGATGAAGGACAGCAACCACTCGGATTCTTTTCAAAAAAATTGAATAAAGCTCAAAGAAAGTATAGCCCATTCGATAGAGAGTTGTTAGCTATCTATGAAGCAGTAAAGCACTTTAGACATATGGTGGAAGGCAGAGTTTTCACTGTGCTTACAGATCACAAACCAATAGTCTCAGCATTCAAAAAAGCATCAGAAAACTGTTCTCCGCGGCAATTTCGCTATTTTGATTTTGTGTCACAATTTACAACCGATGTACGACATATTTCAGGAGACGATAACGTAGTGGCAGACGCTCTTTCCCGCACAGAAGCAATTACGAGTGAGCTTGATATGCATGCTTTAGCATCTTCGCAAAAAGACGACCAAGAACTTCAAAAACTGCTAGAATGCGGCTCTTCACTTGACCTGCAGAAAATCAACATTTCTGGTTCGGGTGAGAGCTTATATTGTGATACTCGTAGCCCTTCTCCTCGACTTTATCTGACGTCACAGTTTCGTAAACAAGCGTTCGATAATATTCACGGGTTGAGTCATCCAGGAGTAAAAGCTACTGTAAGATTGATGACACAGAAATATGTGATGACCAGACCCTAA
Protein
MSFGLCNAAQTFQRFMDEILRDLDFCYPYIDDILIGSQNETLHLEHLKKVFQRLQDHGVVINVSKCVFGEPQVDFLGYAVSSSGTRPLLQKVEAIQNFPQPKTIKELRRFLGMVNFYRRFMPKAANIQAPLHNVLSGPALKPRTPITWSADLLEAFIACKKSLAEATLLAHPNPSAALILCTDASDNAIGAVLQQKTDEGQQPLGFFSKKLNKAQRKYSPFDRELLAIYEAVKHFRHMVEGRVFTVLTDHKPIVSAFKKASENCSPRQFRYFDFVSQFTTDVRHISGDDNVVADALSRTEAITSELDMHALASSQKDDQELQKLLECGSSLDLQKINISGSGESLYCDTRSPSPRLYLTSQFRKQAFDNIHGLSHPGVKATVRLMTQKYVMTRP

Summary

Catalytic Activity
alpha-D-galactose 1-phosphate + UDP-alpha-D-glucose = alpha-D-glucose 1-phosphate + UDP-alpha-D-galactose
Similarity
Belongs to the galactose-1-phosphate uridylyltransferase type 1 family.
EC Number
2.7.7.12
EMBL
LBMM01012030    KMQ86466.1    LBMM01009142    KMQ88359.1    LBMM01012479    KMQ86204.1    + More
LBMM01011855    KMQ86587.1    GEDC01031421    JAS05877.1    LBMM01008151    KMQ89105.1    LBMM01006500    KMQ90563.1    GEZM01017686    JAV90495.1    GFXV01006394    MBW18199.1    LBMM01013040    KMQ85849.1    LBMM01013103    KMQ85815.1    GEZM01003178    JAV96889.1    KL367555    KFD64489.1    IAAA01053083    LAA11740.1    KL367492    KFD69854.1    GGMR01003899    MBY16518.1    GBXI01017046    JAC97245.1    LN877232    CTR11708.1    GDKW01003376    JAI53219.1    GAMC01010904    JAB95651.1    GGMR01010038    MBY22657.1    GBXI01015889    JAC98402.1    KQ973093    EFA13472.2    KL363241    KFD51254.1    GFWV01001714    MAA26444.1    GGLE01002534    MBY06660.1    KL363355    KFD46748.1    LBMM01012134    KMQ86388.1    EF426679    ABP48077.1    GDHC01006393    JAQ12236.1    LBMM01012075    KMQ86423.1    LBMM01012567    KMQ86146.1    MRZV01000184    PIK56201.1    AAGJ04164195    AAGJ04164196    AAGJ04164197    KL367552    KFD64647.1    GBXI01003773    JAD10519.1    GBHO01015475    JAG28129.1    IAAA01033850    LAA08869.1    GEGO01001281    JAR94123.1    LBMM01012160    KMQ86374.1    GBHO01011167    GBHO01011165    GBHO01011164    JAG32437.1    JAG32439.1    JAG32440.1    MRZV01001127    MRZV01000556    PIK40396.1    PIK47817.1    GDHC01002934    JAQ15695.1    MRZV01002078    PIK34788.1    GEZM01036621    JAV82565.1    MRZV01000068    PIK59982.1    GFWV01023619    MAA48346.1    MRZV01001961    PIK35199.1    JYDK01000306    KRX70098.1    JYDK01000002    KRX85197.1    KL367655    KFD60653.1    MRZV01000532    PIK48264.1    JYDW01000445    KRZ48221.1    GDHC01000933    JAQ17696.1    GGFK01003401    MBW36722.1    LBMM01001181    KMQ96765.1    GGFK01003442    MBW36763.1    JYDM01000043    KRZ91508.1    GEGO01000286    JAR95118.1    JYDN01000329    KRX51666.1    GEGO01004484    JAR90920.1    KL367564    KFD63933.1    JYDL01000255    KRX12868.1    GBXI01002896    JAD11396.1    GEGO01003687    JAR91717.1    JYDJ01000268    KRX38449.1    GCES01089026    JAQ97296.1    AAGJ04172791    CAAE01014565    CAF98772.1    CAAE01013629    CAF95050.1    IAAA01040175    LAA10459.1    CAAE01013786    CAF95469.1    JYDH01000101    KRY32299.1    DNYX01000134    HBK82804.1    GBRD01008235    JAG57586.1    GEGO01004649    JAR90755.1    GEGO01004475    JAR90929.1    GFDL01003994    JAV31051.1    JYDS01000231    KRZ20703.1    KL367558    KFD64270.1    GFPF01010655    MAA21801.1    ABLF02007585    GEDV01008182    JAP80375.1    KL367543    KFD65158.1    KL367544    KFD65142.1    GGLE01001814    MBY05940.1    GFPF01012375    MAA23521.1    JYDU01000460    KRX86127.1    JYDM01000363    KRZ82122.1    AAGJ04001742    LBMM01012633    KMQ86092.1    ABLF02030693    ABLF02030697    JYDK01000100    KRX76473.1    JYDK01000369    KRX69330.1    JYDK01000186    KRX73103.1    KL367778    KFD59660.1   
Pfam
PF17919   RT_RNaseH_2        + More
PF17921   Integrase_H2C2
PF00665   rve
PF00078   RVT_1
PF01087   GalP_UDP_transf
PF13359   DDE_Tnp_4
PF01501   Glyco_transf_8
Interpro
IPR041588   Integrase_H2C2        + More
IPR036397   RNaseH_sf       
IPR000477   RT_dom       
IPR012337   RNaseH-like_sf       
IPR001584   Integrase_cat-core       
IPR041577   RT_RNaseH_2       
IPR001995   Peptidase_A2_cat       
IPR021109   Peptidase_aspartic_dom_sf       
IPR001969   Aspartic_peptidase_AS       
IPR034132   RP_Saci-like       
IPR013032   EGF-like_CS       
IPR005849   GalP_Utransf_N       
IPR019779   GalP_UDPtransf1_His-AS       
IPR001937   GalP_UDPtransf1       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR036265   HIT-like_sf       
IPR027806   HARBI1_dom       
IPR029044   Nucleotide-diphossugar_trans       
IPR002495   Glyco_trans_8       
SUPFAM
SSF53098   SSF53098        + More
SSF50630   SSF50630       
SSF54197   SSF54197       
SSF56219   SSF56219       
SSF53448   SSF53448       
PDB
4OL8     E-value=6.59009e-52,     Score=516

Ontologies

Topology

Length:
394
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00146
Exp number, first 60 AAs:
0.00014
Total prob of N-in:
0.00759
outside
1  -  394
 
 

Population Genetic Test Statistics

Pi
130.027668
Theta
45.716041
Tajima's D
3.32721
CLR
2.310555
CSRT
0.990350482475876
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号