SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10159  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA005570
Annotation
PREDICTED:_lethal(2)_giant_larvae_protein_isoform_X2_[Bombyx_mori]
Transcription factor
Location in the cell
Nuclear   Reliability : 2.734
 

Sequence

CDS
ATGGCAGGCAGAATGTTGAAGTTTATACGCGGCAAGGGCCAGCAGCCCTCTGCTGAGAGGCAGAAGTTGCAGAATGAACTATTTGCATTCCGAAAGACAGTCCAGCATGGCTTCCCGCACAGAGCGTCAGCACTCGCGTGGGATCCGCTCCTCAGACTCGCGGCGCTTGGTACCGCCACCGGAGCGCTCAAGGTCTACGGCAGACCAGGCGTCGAACTCTACGGCCAACACACCAATTACGAATCGATAGTCACACAGATACATTTCATCACAGGGACAGGCCGTTTGATATCATTATGCGACGATAACAGCCTTCACTTGTGGGAGATCAACGAGAAATCTCTAGTGGAATTAAAGTCGCATGTATTCGAAGGTAAAAATAAAAAGATATCGGCCATATGCGTAGAATCGTCAGCGAAGAACGCTTTACTGGGAACCGAAGGCGGCAACATTTACTCATTGGATTTGAGCGCTTTCACGATCTCGGAAGATGTCATATACCAGGATGTCGTTATGCAGAACTGCCCAGAGGATTACAAAGTTAACCCAGGCGCGGTGGAGTCTGTATACGAACACCCTAAGACTCCTACACGTATTCTGATCGGATACAACCGAGGACTGGCCGTGCTTTGGGACCGGGAGGCTGCGGCTCCCACACATACATTTGTTTCGAATCAACAGCTTGAAAGCTTATGCTGGAATGACGATGGCGAGCACTTCACATCATCGCACAACGACGGTTCGTACGTGACGTGGGAGGTGGCCGGCGCCTCCAGCGACCGACCCCTGAAGGAGCCCGTCACGCCCTACGGACCCTACCCTTGTAAGGCGATCACCAAGATCCTGAACAGGACTAGCGTTGATGGAGAGGACATCACTATATTTGCCGGTGGCATGCCCAGAGCTTCGTACTCCGACAAGTACACGGTTACAGTGCAGCAGGGCGAGAAACATGTGGCCTTCGACTTCACGAGCCGGGTTATAGATTTGTTCACAACGACCCCCGTGCCCCCGGACGGCGCGCCGCTGCAGGAGGAGCAGCCCGACACCCCGGCCCTCGTACAGGTGCAGGCGGTCAACCAGGTCGCCGCCGCTTTGGTGGTCCTGGCGGAAGAGGAGCTGGTGGTGATAGACCTGTGCGACGCGCGCTGGCGGCCGCTGCGGCTGCCGTACCTGGTGTCGGTGCACGCGTCCGCCGTCACCACGGCGCAGCTGGCCGACGGCGTGGCGCCCGCAGTCTACGACAACATCGTCGCCGCGGGTCAACAACAAACGGAGAATCAATACTCTGAAAGTCCGTGGCCGATTTCCGGTGGGGTGGTGGAGACGGCGGAGCTGACCGACAGACAGGTGCTGCTCACGGGGCACGAGGACGGCTCCGTGCGGTTCTGGGACGTGACCGGCGTCGCCATGACCCCCCTGTACAAGTACACCACCGCGCAGCTGTTCAGTGGTGAAGAACTTGGTGAAAACAACGACAGTCAGACCACAGATGAAGAGGAGTGGCCTCCCTTCAGGCGAGTCGGCACCTTCGACCCGTACAGCGACGACCCCCGGCTCGCGGTCAAAAAGGTTATATTGTGCCCGTTATCTGGAATGCTCACCATCGGCGGAGCCGCCGGCCATATTGTCATAGCCAGTCTCAAGACCTCTCCGAGCACCACCGAAGTCAAGTCGGTGTCAGTGAATATAGTGTCAGACAGAGACGGCTTCGTGTGGAAGGGACACGGGCAGCTCACGTTGAGGGCCGGCACGCACACCTTCCCGCAGGGATATCAGGCGACCTCGGTGGTGCAGCTGCAGCCCCCGGCGGCCGTGACGTCACTGAGCGCGCAGTGGGAGTGGGGCGTGGTGTGCGCCGGCACCGCGCACGGGCTGGCGCTGGTGGACGCGCTGGGCCCGGCACCCGCGCCGCTGCTGCATAAGTGCACGCTCAACCCGCACGATCACGGATCCGGTGACACGCCAATATCGAGAAGAAAGTCCTTCAAGAAATCCTTGAGAGAGTCATTCAGGAGGCTTCGTAAAGGACGTTCACAACGGCGACAGACGACATCGAATCCCACCTCGCCCACACAACCGATTCCGAAGAAGCCAATTGACAAAGCCGCCTCGGAAACGGACGCGGAAATCAAACCGATCGAGCGCGCGGTGGAGGCCCGCTCCACGGACGACGCCTACGGCTCGATGGTGCGCTGCCTGTACTTCGCGAGGACCTTCCTCATCAATACCCAGCAATCGACGCCGACGCTATGGGCCGGCACGAACAACGGCACTGTGTACGCCTTCACGCTGCACGTGCCCAACACTAACAAACGGAAAGAGGAACCAGTAACGTGTCAGCTAGCGAAAGAAATACAGTTGAAGCACAGGGCCCCGGTCATAGGGATCACAGTACTCGACGGCGCCTCCGTACCTCTGCCCGATCCCCTAGAGGTGGAACGAGGTGTGTCCCCGCTACCGGAGCCGGGTACACATCGTGTAGTCATCACGTCGGAGGAACAGTTCAAGATATTCACTCTGCCTTCGTTGAAACCGCACAACAAGTACAAGCTGACCGCGCACGAGGGCGCTCGGGTTCGGCGCACGGCGTGGTCGCAGTTCTCGTGCGGCGCGCACCGGGAGTGGTGCTTGCTGTGCCTCACCAACCTCGGCGACTGCCTCGTGCTCAGCCCGGAGCTGCGCCGCCAGCTCAACGCCGCCGCCGTCAGGAAGGAGGACATCAATGGGATTTCGAGTTTATGTTTCTCGAAACGAGGAGAAGCTCTCTACCTGCACTCGTCTTCCGAATTACAACGGATTACTTTATCTGCTACGAAGGTGACGATCGCGGAGTGCCACGTGCTGTTGGCGCCCTGGGCGGCCGCGCTGCGGGGGCCCGCGCCGGAGCCGCCGCTCACCAACGGGGAGCATAAGGTAGACTGTGTACTCATAGTGGGATTGACGACACAGGAAGAGGTGCCGGAGACAGCTCATGACGTCACGGCGGCCTCGGCGGACATCACCGTGGACAGCGTGCGCGACCACACCAGCGCGGAGCACCCGCCCGAACTCAACATCAACTTGCAGAACACGCAAGTGAATACGAGTTCGATGGTAATAAAGACAACGACGCGCACAACGGTGAACGAGACCAACGCGGACGGCACCACCACCACCACCACCACGACCAGCACTAACAACGCCAACGAGAACATCCTAGAGCACAGTCGCGAGGAGGGAGTCATCACCCGCATCGAGACGGGAACCGTGACGGTGCCGGCCGGCACAGATCCGAAGCTGATCCTCGAGATGTTTGATCGACAACGGTCCCCCCTGGCGGTTGTTAAAAATCCAACCATTACAACAAAACTTTGTGCAAAATGCTACAGAAAAATATTATCATTTCATAAATTTAAATCGCTGGCCATAGAAAATGATATTTATTTAGAAAGTCAGTGTACATCTGCCAAGCACCAGATTCCACTCAATAACAATGAGAATGAGATTGGGCCCACACAACAGTTTAGTATACAAATGGTTGACTGTCTCTCTCCTGAAATGAACAACAAAGATATAATATTCAGAGAACAAGTCAAGACAGAAATGGTATTGGCTCATGATGAAGAAAATGACAGTATCGAGTTAGGAAAATCAGAGCCTCCAGAGTTAGAGTCTGATGATGAATATTTGAGTGTAATTAAAAAAATTAAAACGGAGTATGGTATGGATGGTAAAGATGCTAAGATCAAACGTAAAAATGCTACTAAAAGAAAATCAAATTCCAAAAAGATAGATAATCCAAAAAATAATTTAAAAATGATGTGCGAGGAATGCGGAATTACTGTAAAAGATTTAAAAGAGCATATGAGACAACATCTTCCTCCAGACGAGAGACCAAGAGTCAATTGTCACCTTTGTGAGGAAACGTTTTCATCGGCCAATTCAAAATACAAACATGTGAGACGTAAACATATGAACATCAAACAGAATTGTAAAATCTGTAATAAGGCTGTCGCAAACCTGAAAGCGCACATATTAGTGGTGCACAATACGGAATCACTGCCGTTTGAATGTATAGCATGCGGACGCGGGTTCATATCGAAGTCGCGCCTTGACGTTCATATGGCGGTGCACACCAAGGATCGCCCTCATAAATGCTCATTTTGCATTAAACGGTTTAGGACTAAGATTTGCATGCAGCTACACGAGCGACAAGTCCACAAAAAGGAGAAGAATCATCTCTGTCAGTTCTGTTCGAAAACTTTCTTCAAAAAATATCACTTACAAGTGCATATAAGAACTCACACGAAGGAGAAACCGTACGAATGCAACGAGTGCGGCAAGTGGTTCAGCTCGAAGAACGTGCTGAAGAACCACAAGCTCATACACGAGGACGTCAAGAGATTCGCGTGCACGCTCTGCGATATGTCGTTCATTAGAAACGGGTACCTGCATGCGCACATGCTGTCCCACAAGAAAGAGAAACGCTTCGAGTGTCAGTACTGCGGGGCGAAGTTCCACCGCTCCGACCACAGGAGGCGCCACGAGCACACCGTGCACCGCCGACACCTCGACAACGCTCACGACACACCCTTCACGGCCATATAA
Protein
MAGRMLKFIRGKGQQPSAERQKLQNELFAFRKTVQHGFPHRASALAWDPLLRLAALGTATGALKVYGRPGVELYGQHTNYESIVTQIHFITGTGRLISLCDDNSLHLWEINEKSLVELKSHVFEGKNKKISAICVESSAKNALLGTEGGNIYSLDLSAFTISEDVIYQDVVMQNCPEDYKVNPGAVESVYEHPKTPTRILIGYNRGLAVLWDREAAAPTHTFVSNQQLESLCWNDDGEHFTSSHNDGSYVTWEVAGASSDRPLKEPVTPYGPYPCKAITKILNRTSVDGEDITIFAGGMPRASYSDKYTVTVQQGEKHVAFDFTSRVIDLFTTTPVPPDGAPLQEEQPDTPALVQVQAVNQVAAALVVLAEEELVVIDLCDARWRPLRLPYLVSVHASAVTTAQLADGVAPAVYDNIVAAGQQQTENQYSESPWPISGGVVETAELTDRQVLLTGHEDGSVRFWDVTGVAMTPLYKYTTAQLFSGEELGENNDSQTTDEEEWPPFRRVGTFDPYSDDPRLAVKKVILCPLSGMLTIGGAAGHIVIASLKTSPSTTEVKSVSVNIVSDRDGFVWKGHGQLTLRAGTHTFPQGYQATSVVQLQPPAAVTSLSAQWEWGVVCAGTAHGLALVDALGPAPAPLLHKCTLNPHDHGSGDTPISRRKSFKKSLRESFRRLRKGRSQRRQTTSNPTSPTQPIPKKPIDKAASETDAEIKPIERAVEARSTDDAYGSMVRCLYFARTFLINTQQSTPTLWAGTNNGTVYAFTLHVPNTNKRKEEPVTCQLAKEIQLKHRAPVIGITVLDGASVPLPDPLEVERGVSPLPEPGTHRVVITSEEQFKIFTLPSLKPHNKYKLTAHEGARVRRTAWSQFSCGAHREWCLLCLTNLGDCLVLSPELRRQLNAAAVRKEDINGISSLCFSKRGEALYLHSSSELQRITLSATKVTIAECHVLLAPWAAALRGPAPEPPLTNGEHKVDCVLIVGLTTQEEVPETAHDVTAASADITVDSVRDHTSAEHPPELNINLQNTQVNTSSMVIKTTTRTTVNETNADGTTTTTTTTSTNNANENILEHSREEGVITRIETGTVTVPAGTDPKLILEMFDRQRSPLAVVKNPTITTKLCAKCYRKILSFHKFKSLAIENDIYLESQCTSAKHQIPLNNNENEIGPTQQFSIQMVDCLSPEMNNKDIIFREQVKTEMVLAHDEENDSIELGKSEPPELESDDEYLSVIKKIKTEYGMDGKDAKIKRKNATKRKSNSKKIDNPKNNLKMMCEECGITVKDLKEHMRQHLPPDERPRVNCHLCEETFSSANSKYKHVRRKHMNIKQNCKICNKAVANLKAHILVVHNTESLPFECIACGRGFISKSRLDVHMAVHTKDRPHKCSFCIKRFRTKICMQLHERQVHKKEKNHLCQFCSKTFFKKYHLQVHIRTHTKEKPYECNECGKWFSSKNVLKNHKLIHEDVKRFACTLCDMSFIRNGYLHAHMLSHKKEKRFECQYCGAKFHRSDHRRRHEHTVHRRHLDNAHDTPFTAI

Summary

Pfam
PF08366   LLGL        + More
PF12894   ANAPC4_WD40
PF08596   Lgl_C
PF00400   WD40
Interpro
IPR000664   Lethal2_giant        + More
IPR013577   LLGL2       
IPR015943   WD40/YVTN_repeat-like_dom_sf       
IPR001680   WD40_repeat       
IPR019775   WD40_repeat_CS       
IPR036322   WD40_repeat_dom_sf       
IPR013905   Lgl_C_dom       
IPR017986   WD40_repeat_dom       
IPR024977   Apc4_WD40_dom       
SUPFAM
SSF50978   SSF50978       
Gene 3D
PDB
6N8S     E-value=0,     Score=1805

Ontologies

Topology

Length:
1529
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0422100000000001
Exp number, first 60 AAs:
0.00834
Total prob of N-in:
0.00163
outside
1  -  1529
 
 

Population Genetic Test Statistics

Pi
222.151838
Theta
154.503407
Tajima's D
0
CLR
11.069992
CSRT
0.371431428428579
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
31250652 ITYLFVIVWSYGVCCLLVRAENKPESAVAVHCVAGLGRAPVMVAIALIELGMKYEEAVETIRE 97.96 3e-26
28556443 VNPGAVESVYEHPK 100.00 3e-13
28556443 ASALAWDPLLR 100.00 3e-12
28556443 VVITSEEQFK 100.00 8e-06
26822097 HVAFDFTSR 100.00 1e-05
28467696 TSVAAEKPININIK 100.00 1e-05
28556443 LQNELFAFR 100.00 1e-05
28556443 STDDAYGSMVR 100.00 1e-05
28556443 ASALAWDPLLR 100.00 4e-04
28556443 DHTSAEHPPELNINLQNTQVNTSSMVIK 100.00 4e-04
26822097 ASAIAWDPIIR 100.00 0.007
28467696 IETGIAQVFIK 100.00 0.007
28556443 FWDVTGVAMTPLYK 100.00 0.007
26822097 VGTFDPYSDDPR 100.00 0.009
28467696 VNNYPTPNTCYTVSDIR 100.00 0.009
28556443 VGTFDPYSDDPR 100.00 0.009
28556443 VGTFDPYSDDPR 100.00 0.009
28556443 SVSVNIVSDR 100.00 0.012
26822097 ITISATK 100.00 0.012
28467696 TAVPEFFTNR 100.00 0.012
26822097 IETGTVTVPAGTDPK 100.00 0.019
28556443 TSVDGEDITIFAGGMPR 100.00 0.019
28556443 TSVDGEDITIFAGGMPR 100.00 0.019
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号