SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10123
Annotation
PREDICTED:_uncharacterized_protein_LOC106126637_[Papilio_xuthus]
Location in the cell
Nuclear   Reliability : 3.272
 

Sequence

CDS
ATGCAAATGCATACTCGAGCTCTGTCGGAACAGCTGGAGAAAACCCCTCTCTACGCCGCAGGACATGGGTCATTAGATGAACACAGCCAACTCTTAAAGGAAAACAAAGAAGAAATAGAAAAACTAAGTGAAGAAATAAAAAAGCAAAGGACAGAATGGAAAGAAAATAGGAGCTACGCAAGCGTTGTCAGTGGCACAAAGGAGAAAGAACGCGGAAATGCGGAGATGCATTCCGTCGTGATCTCCTCAGACGACCAGAATGCCACAGGGGAAGACGTATTTAATAAGATCAGGTCAACCCTCAACGCTAAAGAGGAAGGGATAAAAATAGACAGGATAAGAAAGGTGAAAGATAGAAAAGTTATAGTCGGCTGTGAATCGAAAGAAGAATTAGTAAAAATAAGAGAAACAATTAAAACAAAGGGAAAGGACTTACACCTCCAGGAGATAAGAAATAAGGAACCCATGGTACAATTGAAGGATGTCCTGAATTATAATAAGGACGAAGATATAGTGCGAGCACTAATTAACCAGAACAAACATCTTCTGGGGGATGTGAGTGTGGACAGCTCAACTCTGAAGGTAAAGTTCAGAAGAAGAGCTAGAAACCCGCTCACATCCCATGTGGCAATACAAGTGCCACCAAAACTATGGAAGCGGCTCACGGAGGCGGGGCTAGTCCATATAGATGTGCAAAGGGTTAGGGTAGAGGATCAGTCTCCCCTGATTCAGTGCTCGCGATGCTTGGGATATGGCCACGGGAAGCGGTTCTGCCGGGAAAAAATTGACGCCTGCAGTCACTGCGGAGAGGCGCATCATAGGTCGGAATGCGCTGACTGGATGGCGAGGGTGCCTCCGTCGTGCTGTAACTGCTTGAAGGCTAAAATCGGTGAAGCCGAGCATAATGCCTTTAGCCCAGAGTGTCCAGTAAGGAAGAGGTGGGAAACCTTGGCAAGATCTACCGTGACTTATTGCTAA
Protein
MQMHTRALSEQLEKTPLYAAGHGSLDEHSQLLKENKEEIEKLSEEIKKQRTEWKENRSYASVVSGTKEKERGNAEMHSVVISSDDQNATGEDVFNKIRSTLNAKEEGIKIDRIRKVKDRKVIVGCESKEELVKIRETIKTKGKDLHLQEIRNKEPMVQLKDVLNYNKDEDIVRALINQNKHLLGDVSVDSSTLKVKFRRRARNPLTSHVAIQVPPKLWKRLTEAGLVHIDVQRVRVEDQSPLIQCSRCLGYGHGKRFCREKIDACSHCGEAHHRSECADWMARVPPSCCNCLKAKIGEAEHNAFSPECPVRKRWETLARSTVTYC

Summary

Pfam
PF14529   Exo_endo_phos_2        + More
PF00075   RNase_H
PF00078   RVT_1
PF01826   TIL
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR012337   RNaseH-like_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR036397   RNaseH_sf       
IPR002156   RNaseH_domain       
IPR002919   TIL_dom       
IPR036084   Ser_inhib-like_sf       
IPR001878   Znf_CCHC       
IPR036875   Znf_CCHC_sf       
SUPFAM
SSF56219   SSF56219        + More
SSF53098   SSF53098       
SSF57567   SSF57567       
SSF57756   SSF57756       
Gene 3D

Ontologies

Topology

Length:
325
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.03538
outside
1  -  325
 
 

Population Genetic Test Statistics

Pi
197.731203
Theta
50.268899
Tajima's D
4.914501
CLR
6.465269
CSRT
0.999950002499875
Interpretation
Possibly Balancing Selection

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号