SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO09991
Pre Gene Modal
BGIBMGA013209
Annotation
PREDICTED:_LOW_QUALITY_PROTEIN:_uncharacterized_protein_LOC101735587_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 1.33
 

Sequence

CDS
ATGTCTAAGCAGCATATGTATCACTGCTGTGGCACCTGCGAAGTAAAGGTCATGTGCGGAGAACATATTGTCTTGAAACAGTTGAATAACACTGGTCGTCTGTATCTAGAGCCAGGTTGCCTTATAAAGGGATCAGATTATACACTTCATATACCTAAAACAAACAACAATAAGCTGGAGATTCAGTCTAACATTTACGTTCCAATAATAGATCCGATAAATAATATCATAAACAGCTCTCTTCTCAACACTGAGAACCTGAATGTCAGCGAGTCTAAAGATTTGCAGAACGCTCTCCAGAAACTACACGTGCGTATTGAAGATCTAGAAAACTCCCCGCCAGTATTGGAGACTTCATTAACATCTCACGATACTCATCAATATGTGATAACATACATCATCGTCATCGTCATCGTGCTGGCTACCGGCGTGCTACTCTGGCGACGACGACGGTTGAGTGCGAACCGGGCGATCATCTCTGACGATCGAGCTTCAACAGTATAG
Protein
MSKQHMYHCCGTCEVKVMCGEHIVLKQLNNTGRLYLEPGCLIKGSDYTLHIPKTNNNKLEIQSNIYVPIIDPINNIINSSLLNTENLNVSESKDLQNALQKLHVRIEDLENSPPVLETSLTSHDTHQYVITYIIVIVIVLATGVLLWRRRRLSANRAIISDDRASTV

Summary

Pfam
PF12259   Baculo_F        + More
PF17921   Integrase_H2C2
PF00230   MIP
PF05585   DUF1758
PF03564   DUF1759
PF05380   Peptidase_A17
PF00665   rve
PF18701   DUF5641
PF00096   zf-C2H2
Interpro
IPR022048   Envelope_fusion-like        + More
IPR001584   Integrase_cat-core       
IPR000425   MIP       
IPR008042   Retrotrans_Pao       
IPR012337   RNaseH-like_sf       
IPR040676   DUF5641       
IPR023271   Aquaporin-like       
IPR008737   Peptidase_asp_put       
IPR041588   Integrase_H2C2       
IPR036397   RNaseH_sf       
IPR005312   DUF1759       
IPR036236   Znf_C2H2_sf       
IPR013087   Znf_C2H2_type       
SUPFAM
SSF53098   SSF53098        + More
SSF81338   SSF81338       
SSF57667   SSF57667       
Gene 3D

Ontologies

Topology

Length:
167
Number of predicted TMHs:
1
Exp number of AAs in TMHs:
21.10264
Exp number, first 60 AAs:
0.03013
Total prob of N-in:
0.16327
outside
1  -  127
TMhelix
128  -  147
inside
148  -  167
 
 

Population Genetic Test Statistics

Pi
156.002966
Theta
155.478865
Tajima's D
0.081055
CLR
0.012033
CSRT
0.394130293485326
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号