SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO09952  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA013237
Annotation
cytochrome_P450_[Bombyx_mori]
Location in the cell
PlasmaMembrane   Reliability : 2.554
 

Sequence

CDS
ATGTCAGTGAGCGCATTAGTATTTTCCGCCTTCGTTTTATTAGTGACGTATATTTACTATTGGTCGACCCGGAAATTCGATTATTGGAAGCGAAAAAATGTGCCATACGCTAAACCTGTGCCGTTCTTTGGGAACTACATGCGATATATCACACTGCAGAGCTTCCTAGGAGATGTGATGCAGAAGCTGTGCCAGCAGTTCCCTGACAGACCGTACTTCGGATCGTTTTACGGTACGGAACCAGCCCTAGTCTTGCAGAATCCGGAGATCATCAAGCAAGTTTTTACTAAAGACTTCTATTACTTCAACAGCCGCGAAAACAGGGATTACAATCATAAGGAAGTATTCACACAGAACTTGTTCTTCGCCAATGGAGATAGATGGAAGGTAATACGTCAGAACCTAACCCCGCTGTTCTCATCGTCAAAGATGAAGAATATGTTTTACTTGGTGGAAAAATGCAACCATTCCCTTGAAGACATGCTGGACAAGGAAACCAAAGACTTGCAAAGTATTGAGATCCGGTCTGCTATGATAAGGTACACACTGGACTCTATCTGCTCTAGCGCCTTCGGTATCGAAACAAATACCTTAAGTGAGGGCGCAGAAAATAGTCCTTTTCCAAGCATGGGAAGCACCATATTTAGTTCTTCGATAACTCGAGGACTGAAATTGATTGGTCGTTCGATGTGGCCGGGCATATTCTATAAGCTTGGTCTCCGGTGCTTTCCAACGGAAATTGACGATTTCTTTGAGAGACTCCTGACTGAGGTGTTCGAGAACCGTGGCTACAAGCCGACGAACCGTAACGATTTCGTGGACTTAATCTTGAGTCTGAAACAAAACGATTACCTGACCGGAGATGGCTTGGTTCCCAAAAACGTGGACGCAAAGAAAGTGACGGTCAAGGTTGACGACGCCTTATTGATAGCGCAGTGCGTAGTCTTCTTTGGTGCAGGCTTCGAAACGTCAGCTACCACTCTCTCGGCAGCCCTATACGAGCTGGCCAAGAACCCAGAAGCCCAAAGGCGCGCTCAAGAGGAAGTTGACGAACTTTTGCTAAAACACAACAACAAGTTAAATTATGATTGTTTAGCAGAATTACCGTACTTGGAGGCATGTATGAACGAAGCGATGCGTCTGTACCCAGTATTTCCTAATATCACCCGCGAAACCGTTGCCGACTATACGTTTCCCGATGGCCTAAGGATAGATAAGGGTATGCGTGTGCATGTCCCGGTGTATGCTATCCACCGTAACCCCGACAACTTTCCTGACCCGGAAGAGTTTCGTCCTGAGAGACATTTAGGAGACGCCAAAAACGACATTAAGCAGTTCACGTTCTTCCCGTTCGGAGAAGGGCCCAGGATATGCATTGGTATGCGCTTCGGGAAAATGCAGACTATCGCTGGGCTGATTACCTGTTTGAAAAAGTTCAACTTCGAACTGGCGGACGGTATGCCGAGGACGCTAGCTTTTAGATCCACAACGTTGCTTACACAGCCGAGTACCGGATTATTCCTGAAGGCCACACCACGAGACGGATGGGAGCAACGTATTTTCGCACGTTAA
Protein
MSVSALVFSAFVLLVTYIYYWSTRKFDYWKRKNVPYAKPVPFFGNYMRYITLQSFLGDVMQKLCQQFPDRPYFGSFYGTEPALVLQNPEIIKQVFTKDFYYFNSRENRDYNHKEVFTQNLFFANGDRWKVIRQNLTPLFSSSKMKNMFYLVEKCNHSLEDMLDKETKDLQSIEIRSAMIRYTLDSICSSAFGIETNTLSEGAENSPFPSMGSTIFSSSITRGLKLIGRSMWPGIFYKLGLRCFPTEIDDFFERLLTEVFENRGYKPTNRNDFVDLILSLKQNDYLTGDGLVPKNVDAKKVTVKVDDALLIAQCVVFFGAGFETSATTLSAALYELAKNPEAQRRAQEEVDELLLKHNNKLNYDCLAELPYLEACMNEAMRLYPVFPNITRETVADYTFPDGLRIDKGMRVHVPVYAIHRNPDNFPDPEEFRPERHLGDAKNDIKQFTFFPFGEGPRICIGMRFGKMQTIAGLITCLKKFNFELADGMPRTLAFRSTTLLTQPSTGLFLKATPRDGWEQRIFAR

Summary

Cofactor
heme
Similarity
Belongs to the cytochrome P450 family.
EMBL
AK343205    BAM73891.1    AK289291    AK343204    BAM73818.1    BAM73890.1    + More
GQ241737    ADD70250.1    FJ387169    ACJ10074.1    EU309477    ABY40426.1    EF432657    ABO21683.1    EF547545    ABQ42339.1    EU273875    ABX64438.1    EF528486    ABP99020.1    BABH01022694    EF415296    ABN71367.1    AK289290    BAM73817.1    KU145393    ANC96676.1    GU731531    ADE05581.1    JTDY01009617    KOB63214.1    KX443435    ASO98010.1    JTDY01000942    KOB75351.1    NWSH01002736    PCG67605.1    KM016744    AID54896.1    DQ256407    ABB69054.1    KM016742    AID54894.1    KM016736    AID54888.1    KM016738    AID54890.1    JTDY01000272    KOB77971.1    KJ671575    AID55427.1    NWSH01003425    PCG66327.1    KM016741    AID54893.1    AY295774    AAP83689.1    GCVX01000058    JAI18172.1    KM016735    AID54887.1    JN375491    AEY75585.1    JN375489    AEY75583.1    JTDY01005369    KOB67074.1    KM016737    AID54889.1    GU937509    ADW23116.1    RSAL01000158    RVE45547.1    KR095600    AKS48888.1    DQ986461    JN176574    ABI84381.1    AET11931.1    NWSH01002369    PCG68453.1    PCG68452.1    KM016740    AID54892.1    KX443432    ASO98007.1    PCG67604.1    EU807990    ACF17813.2    KX443430    ASO98005.1    KJ671576    AID55428.1    ODYU01000082    SOQ34236.1    ODYU01008863    SOQ52829.1    PCG68451.1    JX310082    AFP20593.1    KP001126    AJN91171.1    GCVX01000081    JAI18149.1    RVE45548.1    FN356971    CAX94849.1    JX310078    AFP20589.1    BABH01022705    EF432656    ABO21682.1    RVE45549.1    KY212044    ARA91608.1    KY212043    ARA91607.1    KQ460655    KPJ12961.1    KY212045    ARA91609.1    JX310077    AFP20588.1    KM016739    AID54891.1    KF701137    AHW57307.1    MH236461    QBA57466.1    KJ645906    AIJ00763.1    ODYU01000083    SOQ34238.1    KQ459388    KPJ01135.1    KX443431    ASO98006.1    GQ915322    ACZ97416.2    KF853191    AHH92929.1    EU273877    ABX64440.1    RVE45546.1    EF535809    ABQ08711.1    KP001127    AJN91172.1    NWSH01000502    PCG75998.1    KX844829    ASQ44127.1    GCVX01000049    JAI18181.1    KZ150141    PZC72944.1    AK343206    BAM73892.1    FN544262    CBB07053.1    KM016743    AID54895.1    KX443433    ASO98008.1    KJ645904    AIJ00761.1    JX310083    AFP20594.1    ODYU01004424    SOQ44278.1    KX443434    ASO98009.1    KJ645907    AIJ00764.1    KJ645905    AIJ00762.1    EF528485    ABP99019.1    BABH01022698    MH151918    QAX33066.1    KJ645908    AIJ00765.1    GU731530    ADE05580.1    KJ645909    AIJ00766.1    ODYU01004193    SOQ43795.1    ODYU01004192    SOQ43793.1   
Pfam
PF00067   p450        + More
PF09453   HIRA_B
Interpro
IPR036396   Cyt_P450_sf        + More
IPR002401   Cyt_P450_E_grp-I       
IPR001128   Cyt_P450       
IPR017972   Cyt_P450_CS       
IPR019015   HIRA_B_motif       
IPR002403   Cyt_P450_E_grp-IV       
IPR002402   Cyt_P450_E_grp-II       
SUPFAM
SSF48264   SSF48264       
Gene 3D
PDB
5VCG     E-value=5.27986e-52,     Score=518

Ontologies

Topology

Length:
523
Number of predicted TMHs:
1
Exp number of AAs in TMHs:
25.12513
Exp number, first 60 AAs:
21.43395
Total prob of N-in:
0.59126
POSSIBLE N-term signal
sequence
inside
1  -  4
TMhelix
5  -  22
outside
23  -  523
 
 

Population Genetic Test Statistics

Pi
277.292734
Theta
167.714848
Tajima's D
1.873104
CLR
0
CSRT
0.864756762161892
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
26822097 NMFYIVEK 100.00 5e-04
28467696 NPDGVAFR 100.00 5e-04
26822097 IITEVFENR 100.00 0.036
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号